KEGG   Chlamydia trachomatis A/HAR-13: CTA_0184Help
Entry
CTA_0184          CDS       T00280                                 

Gene name
trpB_2
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTA_0184 (trpB_2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTA_0184 (trpB_2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTA_0184 (trpB_2)
Enzymes [BR:cta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTA_0184 (trpB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195174..195362
Genome map
AA seq 62 aa AA seqDB search
MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCILKNYAGRQTPLTEVKN
FA
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacataaacatccttttgggggagcgttccttcccgaagaactattagcccct
atacagaatctaaaagcggaatgggagattctcaaaactcagcaaagttttttatctgaa
ctagattgtattttgaaaaactatgcggggagacaaactcctctgactgaagttaagaat
tttgcttga

DBGET integrated database retrieval system