KEGG   Chlamydia trachomatis A/HAR-13: CTA_0185Help
Entry
CTA_0185          CDS       T00280                                 

Gene name
trpB_1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTA_0185 (trpB_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTA_0185 (trpB_1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTA_0185 (trpB_1)
Enzymes [BR:cta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTA_0185 (trpB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195405..196352
Genome map
AA seq 315 aa AA seqDB search
MHTGAHKLNNALGQCLLAKYLGKTRVVAETGAGQHGVATATACAYLGLDCVVYMGAKDVE
RQKPNVEKMRFLGAEVVSVTKGSCGLKDAVNQALQDWATTHSFTHYCLGSALGPLPYPDI
VRFFQSVISAEVKEQIHAVAGRDPDILIACIGGGSNAIGFFHHFIPNPKVQLIGVEGGGL
GISSGKHAARFATGRPGVFHGFYSYLLQDDDGQVLQTHSISAGLDYPSVGPDHAEMHESG
RAFYTLATDEEALRAFFLLTRNEGIIPALESSHALAHLVSIAPSLPKEQIVIVNLSGRSD
KDLSQIIRRNRGIYE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgcatacaggagcacataaactgaataatgctcttggtcagtgtttgcttgctaaatat
cttgggaaaacacgtgttgtagctgaaacaggtgcgggacaacatggagtagcaacagca
acagcatgtgcttatctaggattagattgtgtagtatacatgggagcaaaagatgtggaa
cgacagaaaccaaatgtagagaaaatgcgctttttaggtgctgaagtcgtttctgtaaca
aaaggatcttgtggactcaaagatgcagttaatcaagctctacaagattgggcaacaaca
cactcatttactcactattgcttaggatcggccttaggacctttaccttatcccgatatc
gttcgattttttcagtctgttataagcgctgaagtgaaagagcaaatccatgcagttgca
ggaagagatcctgatattctgattgcatgtatcggaggtggctccaacgctattggattt
ttccatcattttatcccgaatccaaaagtccaattaattggagtggaagggggaggactg
ggcatttcttcaggaaaacatgcagcacgttttgcaacagggcgacctggagtattccac
ggattttattcgtatcttcttcaagatgacgatggacaagtattacaaactcactccatt
tccgctggattagattatccttcagttgggccagatcatgccgaaatgcatgagtcagga
cgagccttttatacattagccaccgatgaagaggcgttacgagcttttttcctgcttact
agaaacgaggggattattcctgcattggagtcttcacatgctctcgcacatttagtttcg
attgctccttctctaccaaaggaacaaatcgtcatcgttaacttatctggaagaagtgat
aaggatctttcacaaatcatccgcagaaacagaggaatttatgagtaa

DBGET integrated database retrieval system