KEGG   Chlamydia trachomatis A/HAR-13: CTA_0186Help
Entry
CTA_0186          CDS       T00280                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
cta00260  Glycine, serine and threonine metabolism
cta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cta01100  Metabolic pathways
cta01110  Biosynthesis of secondary metabolites
cta01130  Biosynthesis of antibiotics
cta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTA_0186 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTA_0186 (trpA)
Enzymes [BR:cta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTA_0186 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Phage_Nu1
Motif
Other DBs
NCBI-ProteinID: AAX50430
UniProt: A0A0H2X0J8
Position
196345..196896
Genome map
AA seq 183 aa AA seqDB search
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFEDLLAVGLDPILLISAGTTPERMSLIQEHARGLLYYIPYKLRE
ILK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagccatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccttttgaagatctt
ttagctgtaggattggatcctattttgcttatttctgcagggacaacgccggagcggatg
tctttaatacaagaacacgcaagaggccttctgtattatatcccatacaagctacgagag
attctgaagtag

DBGET integrated database retrieval system