KEGG   Chlamydia trachomatis A/HAR-13: CTA_0435Help
Entry
CTA_0435          CDS       T00280                                 

Gene name
sucB_2
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTA_0435 (sucB_2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTA_0435 (sucB_2)
  Amino acid metabolism
   00310 Lysine degradation
    CTA_0435 (sucB_2)
Enzymes [BR:cta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTA_0435 (sucB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(460790..461956)
Genome map
AA seq 388 aa AA seqDB search
MFEFRFPKIGETASGGIVVRWLKQVGDPVQKDEPLIEVSTDKIATELAPSQAGILEECLV
QEGEEVFPGDILARLLETAAANTPVKSPVENPVREENHSVDREQKWFSPAVLGFAQREGL
DLQELQKISGTGEGGRITRKDVEHYLSDKREPRDPICSKEENRIPLSPLRRAIASSLRQS
SEEVPHASLVVDVDVTDLMNLISAERERFTAAHGVKLTITSFIIQCLAKSLEQFPLLNGS
LDGDTIVLKKAINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKVLADLSSRARSNKLDSS
ETKGGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMMCVTLT
FDHRVLDGIYGGEFLTALKNRLESVTMS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtttcgatttccaaaaataggggagaccgcatctggaggtattgttgtccga
tggttgaaacaggtcggagatcctgttcaaaaagatgagccattgattgaggtctcaaca
gataagatagctacagagttagctccttctcaagctggcattttggaggagtgcctggtt
caggaaggggaagaggttttccctggagatattctagcgcgtttgctagaaactgctgca
gcgaatactcctgtaaaaagccctgtggagaatcctgttagagaagagaatcattctgta
gatagagagcagaaatggttctcgcccgcagtattaggatttgcccaaagagaagggtta
gatcttcaagaattacaaaagatctcggggacaggagaggggggacggattactcgtaag
gatgtagaacactatctttccgacaagagagaacctagggatccgatctgttctaaagag
gaaaatagaattcctttgtcacctttacgtcgggctatcgcttcttctttacgacagtct
tcagaagaggtgccgcatgcttctctggttgttgatgtagatgttacagatttaatgaat
ctcatctctgcggagcgagagagatttactgctgctcatggagtgaaactcacgatcacc
agcttcattatacagtgcttagctaagtctttagagcagttcccactgcttaatggttct
ttagacggggatacgattgtcctcaagaaggctataaatgtaggagttgctgtaaatttg
aataaagaaggagtagttgttcctgttattcataattgtcaggataggggtcttgtaagt
attgctaaggttcttgcggatctttcttcaagggcgcgatctaataaattagattcctca
gaaacgaaagggggaagcgtcactgtaaccaactttggtatgactggagctcttattggc
atgccgataattcgttatccggaagtagcgattttggggatcggaacaattcaaaaacga
gtggttgtacgtgatgatgactcgttagccattaggaaaatgatgtgtgtcactttaact
ttcgaccatcgagtattggatggaatttacggtggagagtttttaacagctttgaaaaat
cgcttagagtctgttacgatgagctag

DBGET integrated database retrieval system