KEGG   Chlamydia trachomatis A/HAR-13: CTA_0549Help
Entry
CTA_0549          CDS       T00280                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cta03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(582814..583416)
Genome map
AA seq 200 aa AA seqDB search
MYEYIKGTLTHINESYVVIESFGIGYAIMLSERFSVDLRAFMHQEVLIYVHSVIRETEHV
LYGFSSRAEKECFRLLISFSGIGPKTGLSILNMFPLQELCSIARLENVKAIASVPGIGKK
TAEKLMVDLKQKLPTLMPLYLEEPVVPSSTANSSFKEGIGALMNLGFSRLAADRMMTEAV
KELSEEASVAELLPIALRKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtatattaaaggcactttgactcatattaatgagtcttatgttgtgattgaa
agcttcggcataggatatgctattatgctttctgagcgtttttcagtagatttgcgcgca
tttatgcatcaagaggtgctgatttatgttcatagcgtcattcgtgaaactgagcacgtt
ctatacggttttagctctcgcgctgaaaaggagtgttttcgtttattaatttctttttct
ggtattggccctaaaacaggactatctattttaaatatgttccctttgcaagagttgtgt
tctattgcgcgcttagaaaatgtgaaagctattgcgtctgttcctgggatagggaaaaaa
acagcagaaaagctgatggtggatcttaaacaaaaacttcctactttgatgcccctttac
ttagaggaacccgtagttccttcctcgacagcgaattcttctttcaaagaaggaatcgga
gctctaatgaatcttgggttctctcgtcttgcagcagatcgtatgatgaccgaggctgta
aaagaattatctgaagaagcttcagtagccgaactgcttcctatagcattaagaaaaagc
tag

DBGET integrated database retrieval system