KEGG   Chlamydia trachomatis A/HAR-13: CTA_0850Help
Entry
CTA_0850          CDS       T00280                                 

Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cta  Chlamydia trachomatis A/HAR-13
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918234..918728
Genome map
AA seq 164 aa AA seqDB search
MRNWLLGSLLIACMAVTAPCFAAKRRAAGSQKINRVAETGIHWMSYQDALNKAKQEGKHV
AVFFTGSDWCIWCMRMQDQILQTAAFSEFAKQYLCMVEIDFPHNKEQTAEQKEQNRHLKS
LYSVDGFPTLVLLDSEGKEVAKMGFEPGGGEAYVYRLKKALHIS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactggttattagggagcttgctcatcgcatgtatggcggtcacagctccttgt
tttgctgcaaaacgtcgtgctgcgggttcgcagaagatcaatagggttgcagagaccgga
attcactggatgtcttatcaagatgctttgaataaggcaaaacaggaaggaaagcatgta
gccgtatttttcacaggatccgattggtgtatttggtgtatgagaatgcaggatcagatt
ttacaaacagctgcattttccgagtttgctaaacaatatttgtgtatggtggagatagat
ttccctcacaacaaagaacaaactgcagaacaaaaagagcagaatcgtcatttgaaaagt
ttatattctgtagacggattccctaccctagttttactcgattccgaaggtaaagaagtc
gcaaaaatgggatttgagcctggaggcggagaggcatatgtttatagattaaagaaagca
ttacatatctcctga

DBGET integrated database retrieval system