KEGG   Chlamydia trachomatis A/HAR-13: CTA_0853Help
Entry
CTA_0853          CDS       T00280                                 

Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cta  Chlamydia trachomatis A/HAR-13
Brite
Enzymes [BR:cta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CTA_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
922285..923334
Genome map
AA seq 349 aa AA seqDB search
MSSLRIARSCSFKQKTLLAALVFFGLGASQVCATPSNSREIAWYVDYQEARDESREKDLP
MLLFFSGSDWNGSCMKIRDEVLSSSDFISAVADQFVCVVVDFPRHTELRDPLINEQNEDL
KNRLHVNTFPSLVLLSPEERAIYKIESFGNENGSNLGESLCRVIANDQELEQVFPFIPTL
SSVELRKYYQLAEELSRKDFMATALEQGVLCDDSFFLSEKFRQLVEAGRMDSEECRAVKN
RLLELDPENEQLTHFTVALIEFQELAKRSQGQSHVNVAEVIAPLAEYLTQFREQDKENQW
RLEMIISQYYLDAGLPNSALEHAKIAFESAPQDIQSSISRSLVHIEHQS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctttacggattgctagaagttgctctttcaagcagaaaactcttttggctgcc
ctagttttctttggactaggtgcgtctcaggtatgcgctactccttctaattccagagag
attgcttggtatgtagattatcaagaagctagggacgagagtagagagaaagatttgccc
atgttgttgtttttctctggctctgattggaatggtagttgtatgaaaatccgtgatgaa
gtgctaagctcgtcggatttcatctcagctgttgctgaccaatttgtgtgcgtagttgtc
gatttccctcgtcatacagagttgcgagatcctctcataaacgagcaaaatgaagattta
aagaatagactgcatgtcaataccttccctagtttggtattgttgtcccccgaagaacga
gcgatttataagatcgaaagttttggaaatgaaaatggatcgaatctaggagagagcttg
tgcagagtcattgctaatgaccaggaactagaacaagttttcccattcatccctacacta
tcttcggtagagttacgaaaatactatcagctcgctgaagagctatcgcgaaaagatttc
atggcaacagctcttgagcagggggtgttgtgcgatgatagctttttcctatccgagaag
tttcggcagctcgttgaagcgggtagaatggattcagaggagtgtcgtgctgtgaagaat
cggttgctagaattagatcctgagaatgagcagctcacgcatttcacagtggctttaatt
gaatttcaagagttagctaaacgttctcaagggcagtcgcacgtgaatgttgctgaagta
atcgcacctttagcagaatatcttacgcaatttagagaacaggataaagagaaccagtgg
agacttgagatgattatttctcaatattatctcgatgctgggctccctaatagtgcgcta
gagcacgcaaagatagcttttgaatcggctccgcaagatatccaatccagcatttcccgt
tcgttagtgcatatagaacaccaatcctaa

DBGET integrated database retrieval system