KEGG   Chlamydia trachomatis A/HAR-13: CTA_0876Help
Entry
CTA_0876          CDS       T00280                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
cta00900  Terpenoid backbone biosynthesis
cta01100  Metabolic pathways
cta01110  Biosynthesis of secondary metabolites
cta01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cta00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTA_0876 (ispE)
Enzymes [BR:cta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CTA_0876 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AAX51085
UniProt: Q3KKN7
Position
942587..943453
Genome map
AA seq 288 aa AA seqDB search
MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLQVINACHLETP
SNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDE
EMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEESVSDRYVLYFSSEGVLTSRAFAAV
QPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVYIGLTGSGATLFVRY
PEILEKDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcactttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaa
gatgattttcacgaaatagtcacacgctatcaagcgatagcctttggggatcaactctcc
ttatcaataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcct
agtaattctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcct
gttagttggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagt
aatgcagcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgag
gaaatgcgttccttagccgaacagcttggcgtggatactccttttttcttttctacagga
gcagccttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagat
agatatgttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgccgta
caaccttcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaag
cctgtttttcggttgcgcttagatttgaaagaaaagaaacattggctagaaagcctgtgg
gcggaacttcctgtgtatatagggctaacgggatcaggggcaaccttatttgtccgttac
ccagaaatcttagagaaagacctttcttatgcagctcagatacaaagagcagtaacgtta
agcggaggattattgacttctccgatacgaagagatcctacagcttggtatagcatctat
tctgaaagtgcacttgcagctacataa

DBGET integrated database retrieval system