KEGG   Chlamydia trachomatis L2/434/Bu: CTL0091Help
Entry
CTL0091           CDS       T00645                                 

Gene name
pgmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
ctb00010  Glycolysis / Gluconeogenesis
ctb00260  Glycine, serine and threonine metabolism
ctb00680  Methane metabolism
ctb01100  Metabolic pathways
ctb01110  Biosynthesis of secondary metabolites
ctb01120  Microbial metabolism in diverse environments
ctb01130  Biosynthesis of antibiotics
ctb01200  Carbon metabolism
ctb01230  Biosynthesis of amino acids
Module
ctb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTL0091 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    CTL0091 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTL0091 (pgmA)
Enzymes [BR:ctb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTL0091 (pgmA)
Membrane trafficking [BR:ctb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTL0091 (pgmA)
Exosome [BR:ctb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTL0091 (pgmA)
  Exosomal proteins of melanoma cells
   CTL0091 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 5858631
NCBI-ProteinID: YP_001654182
UniProt: B0B8U8
Position
complement(113671..114351)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
MTALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAVQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
atgacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaactccaaggaaaaaataaa
caagaagtcgctgttcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system