KEGG   Chlamydia trachomatis L2/434/Bu: CTL0152Help
Entry
CTL0152           CDS       T00645                                 

Definition
(RefSeq) hypothetical protein
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Brite
Enzymes [BR:ctb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CTL0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_7 Thioredoxin_8 Thioredox_DsbH Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 5858606
NCBI-ProteinID: YP_001654243
UniProt: A0A0H3MCK9
Position
199370..200419
Genome map
AA seq 349 aa AA seqDB search
MSSLRIARSCSFKQKTLLAALVFFGLGASQVCATPSNSREIAWYVDYQEARDESREKDLP
MLLFFSGSDWNGSCMKIRDEVLSSSDFISAVADQFVCVVVDFPRHTELRDPLINEQNEDL
KNRLYVNTFPSLVLLSPEERAIYKIESFGNENGSNLGESLCRVIANDQELEQVFPLIPTL
SSVALRKYYQLAEELSRKDFMATALEQGVLCDDSFFLSEKFRQLVEAGRMDSEECRAVKN
RLLELDPENEQLTHFTVALIEFQELAKRSQGQSHVNVAEVIAPLAEYLTQFGEQDKENQW
RLEMIISQYYLDAGLPNSALEHAKIAFESAPQDIQSSISRSLVHIEHQS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctttacggattgctagaagttgctctttcaagcagaaaactcttttggctgcc
ctagttttctttggactaggtgcgtctcaggtatgcgctactccttctaattccagagag
attgcttggtatgtagattatcaagaagctagggacgagagtagagagaaagatttaccc
atgttgttgtttttctctggctctgattggaatggtagttgtatgaaaatccgtgatgaa
gtgctaagctcgtcggatttcatctcagctgttgctgaccaatttgtgtgcgtagttgtc
gatttccctcgtcatacagagttgcgagatcctctcataaacgagcaaaatgaagattta
aagaatagactgtatgtcaataccttccctagtttggtattgttgtcccccgaagaacga
gcgatctataagatcgaaagttttggaaatgaaaatggatcgaatctaggagagagcttg
tgcagagtcattgctaatgaccaggaactagaacaagttttcccactcatccctacacta
tcttcggtagcgttacgaaaatactatcagctcgctgaagagctatcgcgaaaagatttc
atggcaacagctcttgagcagggggtgttgtgcgatgatagctttttcctatccgagaag
tttcggcagctcgttgaagcgggtagaatggattcagaggagtgtcgtgctgtgaagaat
cggttgctagaattagatcctgagaatgagcagctcacgcatttcacagtggctttaatt
gaatttcaagagttagctaaacgttctcaagggcagtcgcacgtgaatgttgctgaagta
atcgcacctttagcagaatatcttacacaatttggagaacaggataaagagaaccagtgg
agacttgagatgattatttctcaatattatctcgatgctgggctccctaatagtgcgcta
gagcacgcaaagatagcttttgaatcggctccgcaagatatccaatccagcatttcccgt
tcgttagtgcatatagaacaccaatcctaa

DBGET integrated database retrieval system