KEGG   Chlamydia trachomatis L2/434/Bu: CTL0285Help
Entry
CTL0285           CDS       T00645                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
ctb00230  Purine metabolism
ctb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CTL0285 (gmk)
Enzymes [BR:ctb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CTL0285 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin dNK Stealth_CR3 AAA_22 AAA_16 AAA_17 Zeta_toxin AAA_23 AAA_33 AAA_30 AAA RNA_helicase TsaE
Motif
Other DBs
NCBI-GeneID: 5858565
NCBI-ProteinID: YP_001654369
UniProt: A0A0H3MBI9
Position
356045..356662
Genome map
AA seq 205 aa AA seqDB search
MSVKVISPFSQDGVQCFPKLFIISAPAGAGKTTLTHMLQREFPDAFEKTVSSTTRSARPG
EVHGVDYLFVSEDDFKQSLDREDFLEWVFLFGTYYGTSKAEISRVLQKGKHCIAVIDVQG
ALALKKQMPAVTIFIQAPSQEELERRLNARDSEKDFQKKERLEHSAVEIAAASEFDYVVV
NDDLITAYQVLRSIFIAEEHRMSHG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaggttatttcccccttttctcaagacggggttcaatgctttcccaagctt
tttatcattagcgctcctgctggagcagggaagacaacactcacccatatgctacaaaga
gagtttcctgatgcatttgagaagacggtgtcgtcaacgacacgttcggctcgtccaggc
gaagtgcatggcgtggattatttgtttgtatctgaagatgactttaagcaatctttagat
agggaagattttttggaatgggtctttttatttgggacttattacggaacgagtaaggcg
gagatttctagagttctgcaaaagggtaagcactgcatagccgtgattgatgtacaagga
gctttggctctgaagaagcaaatgccggcagtcactatttttattcaagctccctctcaa
gaagaacttgagcgccgtttgaatgctcgggattcagagaaagatttccagaagaaagaa
agattagagcatagcgctgtcgaaattgctgccgctagcgaatttgattatgttgtggtt
aatgatgatttgattacagcatatcaagttttaagaagtatttttatagctgaagaacat
aggatgagtcatggctag

DBGET integrated database retrieval system