KEGG   Chlamydia trachomatis L2/434/Bu: CTL0311Help
Entry
CTL0311           CDS       T00645                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ctb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ctb00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ctb00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385949..387046
Genome map
AA seq 365 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGDLVQENQGILEIESDKVNQLIYAPCSGRVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRKE
RQEDFVAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRGL
VVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQPE
LLLKM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatctattagtgaagtgacgatttct
gcacttttgattccatcaggagatttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaagggtagagtggagcgtt
tccgtaggggatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagataccgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagatccaaccagcttcttctgatcatagagaatctcgagaa
tctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgattca
gcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaaggaa
agacaagaagatttcgttgcgaagtatggggtaaaactggggttcatgtctttctttgtt
agagccgttgtagattctttgaaaaaatatcctcgggtgaatgcttatattgaagataac
gaaatcgtttacagacattactacgatatttccattgccatagggacagatcgtggatta
gtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacagctt
gccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggggga
ggcttcactattaccaatggaggggtatatggttctcttctatccactcccattatcaat
cctccacaggtaggtattcttgggatgcacaagatagagaaacgccctgtggttagagaa
gatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggattata
gacggaaaggaagccgtaggattccttgtgaatgttaaagagcaattagaacaacccgag
cttttgctaaaaatgtag

DBGET integrated database retrieval system