KEGG   Chlamydia trachomatis L2/434/Bu: CTL0327Help
Entry
CTL0327           CDS       T00645                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTL0327 (dxr)
Enzymes [BR:ctb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CTL0327 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406148..407287
Genome map
AA seq 379 aa AA seqDB search
MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAYGRNQEALISQIREFNPRVVAVREE
TTYKELRKLFPHIEILLGEEGLVSVATEPSVTITIVASSGIDALPAVIAAIRQKKTIALA
NKESLVAAGELVTTLARENGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNK
SKEELQKVSLQEVLRHPVWNMGPKITVDSSTLVNKGLEIIEAFWLFGLEAVEIEAVIHPQ
SLVHGMVEFCDGTILSVMKPPSMLFPIQHVLTFPERSPAIGPGFDFLSNRTLEFFPIDED
RFPSVHLAKRVLLEKGSMGCFFNGANEALVHRFLAGEISWHQIVPKLQALVDQHRVQSCL
SLEEILSVDAEARARAQEC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcatttagcactgattgggtcaacagggagtattggtagacaggttttacaagta
gttcgttctattcccgatacttttattatagaaactcttgctgcgtatggacggaatcaa
gaagcattgatctctcagattagagagtttaatcctcgagtggtagccgttcgtgaagaa
acaacttacaaggagctccgtaagttattccctcatattgagattcttttaggagaagag
gggttagtttctgttgctacagaaccttctgtaacaataaccattgtagcttcgtctggt
atagatgctttaccagcagtcattgcagctatccgacagaaaaagacaatagctttggct
aataaagagtcgttagtggcagctggagagttggttaccactttggctagagagaatggt
gtgcagattcttcccatcgatagtgaacataacgcacttttccagtgcttagaaggaaga
gactcttctaccattaaaaaattattgttaacagcttctggagggccgttaaggaataaa
tcaaaagaagaattacaaaaggtctctttacaagaggtcttgcgacaccctgtttggaat
atggggcccaaaattacagtagattcttctaccttagtaaataaaggcttagaaattata
gaagctttctggctatttgggctggaagctgtagagatagaggcggtgatccatcctcaa
agtcttgttcatggaatggtggagttttgtgatggaacgatcctttctgtgatgaagcct
cccagtatgctatttccaatacaacatgttttgactttcccagaacgtagccctgcaata
ggtccaggattcgattttctttcaaatcgcactctagagtttttcccgatagatgaagat
agattccctagtgttcatctagcgaagcgagtgcttcttgaaaaggggtctatggggtgt
tttttcaatggcgccaatgaggctttggttcatcgatttttagcaggcgagatttcttgg
catcaaatagttcctaaattacaagctcttgtggatcagcatcgcgtgcaatcctgttta
tccctggaagaaattctatcggtagatgctgaggccagagctcgtgctcaagagtgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system