KEGG   Chlamydia trachomatis L2/434/Bu: CTL0361Help
Entry
CTL0361           CDS       T00645                                 

Definition
tRNA pseudouridine synthase A
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Brite
Enzymes [BR:ctb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     CTL0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(445045..445869)
Genome map
AA seq 274 aa AA seqDB search
MQEFIGTADRHIRLSSFLRTSLPHLPKKTILESVRYHGCRVNGRIERFESYKLQPGDRVS
LQIIEHSSPQLLWEDEHLCIYNKPAKQTSEDLAHQLNVHLVHRLDRDTSGCILFAKHAKA
SSLITQLFKNREIDKRYIALVFGQPRQESGIITTYTAPCYRRTGAVLFGNTDQNSGKITI
TKWEILTRYPKYTLLLCRPVTGRTHQIRLHMKTIGHPIVGDVDYGNQEQPKNVVRTLLHA
ASLAFISPFSNEKIEISSLTPSQDPYPFYADFRP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatttattggtacagcggatcgccacataaggctctcttcttttctccggact
tctctgcctcatctgcctaaaaaaactattttagaatccgttcgctatcatggttgccga
gtcaatggtcgcattgaacgcttcgaatcctataagctgcagcccggagaccgagtaagt
ttacaaatcatcgaacactcttctccacaattactttgggaggatgagcatctctgtatt
tacaataaacctgctaaacagacttccgaggatttggctcatcagctcaatgttcatctt
gtgcaccgcttagatcgagatacatcagggtgtattctctttgcgaaacatgcaaaagcc
tcttctcttattacacaactattcaagaatcgagaaatagataaacgctatattgctcta
gtatttggacaaccacgccaagaatctggaatcattacaacctatacagccccctgctac
cgtcgaactggtgctgtattatttggaaatacggatcaaaattccggtaaaataacgatt
accaagtgggagattcttacccgctatcccaagtacactttacttctttgccgccccgtt
acaggacgcacccatcaaatacgcttacatatgaaaacaatcggccatcctattgttggg
gatgtggattacggaaatcaagaacagccaaagaatgttgtgcggactttgcttcacgca
gctagcttagccttcatttctcctttctccaatgaaaaaatcgaaatctcctctctaacg
ccatcacaagacccttaccctttttacgcagattttaggccttaa

DBGET integrated database retrieval system