KEGG   Chlamydia trachomatis L2/434/Bu: CTL0457Help
Entry
CTL0457           CDS       T00645                                 

Gene name
pfkA
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTL0457 (pfkA)
   01230 Biosynthesis of amino acids
    CTL0457 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTL0457 (pfkA)
   00030 Pentose phosphate pathway
    CTL0457 (pfkA)
   00051 Fructose and mannose metabolism
    CTL0457 (pfkA)
   00052 Galactose metabolism
    CTL0457 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CTL0457 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CTL0457 (pfkA)
Enzymes [BR:ctb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTL0457 (pfkA)
Protein phosphatases and associated proteins [BR:ctb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTL0457 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548519..550180
Genome map
AA seq 553 aa AA seqDB search
MSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYNSPYYKF
ISKSDLSAETFPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPDSQLLGFIRNGEGLLNN
NTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIGGDGSNT
ATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNISRDALS
CKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICEIIADRAA
MGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPEDICHQL
LYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTPTHFDNV
YSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSKHYPLIK
KRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLNHNEWQK
RCSICLEIPDQDY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaataaacatgcttctctttgtcaaaagacgccttctttgtgtcgggagctt
caaaaagctcctgctcttctattaacagaagacataaggtttaaagctcttcttaatgaa
cgcattgactctgttgcagaactatttccatgcacttataactctccctactacaaattt
atttcgaagtccgatctttccgctgagacctttccccttaaagtgggcgttatgctttct
ggaggcccagctcctggtgggcacaatgtcatcttaggattgctacacagtattaaaaag
ctccatccggatagtcagcttttaggatttattcgcaatggagaaggacttctcaataat
aatactgtagaaatcacagatgaattcattgaagagtttcgtaactctggaggctttaat
tgcataggaacaggtcgcactaatatcataaccgaagaaaacaaagcgcgctgtttacaa
acagcaaatgaactcgatttagatggattagtgattattggaggcgatggttcgaataca
gccacggcgattcttgctgaatattttgctaagcatcaagcaaaaacggtattagttggt
gttcctaaaactattgatggagatttgcagcacctatttttagacctcacatttgggttt
gatactgctactaaattttattcatccatcatcagcaacatttctagagacgcattatcg
tgtaaaggccactatcattttattaaactaatgggccggtcttcttctcatatcacgcta
gaatgcgcactacagactcacccaaatattgctcttataggcgaagagattgcagaaaaa
agcatctccttagaaacattaatccatgatatttgtgaaataatagcagatcgagctgct
atggggaaataccatggcgttattctcatccctgaaggagtcattgagtttattcctgaa
atacagtctctggttaaagaaattgaatccattccagagcaggagaatctttaccaagct
ttatccttatcttctcagcaacttttatgccaatttccggaagatatttgccatcagctc
ttgtataatagagatgctcatggcaacgtctatgtatcaaaaattagtgttgataaactt
ctgattcatctagttcgtcaacatttagaaacacattttagacaagttcccttcaatgca
atctcccattttttaggttatgaagggcgttcaggaactcctacacattttgataatgtg
tatagctataacttaggatatggtgctggggttctcgtttttaaccgctgtaatgggtat
ttatccacgatcgaaggtctaactagccctattgaaaaatggcgattgcgcgctttaccc
attgttcgaatgttgacgaccaagcaggggaaagacagtaaacattatcctctgataaaa
aaaagattggtagatattgctagtcctgtttttaataagttctcactgtatcggaaaatc
tgggctttagaagactcctatcgctttgtagggccattacaaatacattctccggaggat
gctcattctgatgattttcctcctttaattttgtttttgaatcataatgaatggcaaaaa
cgctgttctatttgtttagaaatccccgatcaggattattaa

DBGET integrated database retrieval system