KEGG   Chlamydia trachomatis L2/434/Bu: CTL0692Help
Entry
CTL0692           CDS       T00645                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ctb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821396..822067
Genome map
AA seq 223 aa AA seqDB search
MPLYLGLNPSSAKQYSAVFQPIIRIVPFSKHVPQIRHARKFLVSASHILLTSPSSTACFF
SSIRKRIPLSLFRNKSFVTIGEASSSRVKAFLPKANIVQSAFPQAEAFLPILSTLPSSSS
LLYPHSVLARPILRSLLQTLPFSSFSYPHYTVKPITLSVSTFLPHKTIILTSPSIVRAYA
QLFPCLPDKEHWCLGEISAAEFKQIFHTPPSKILFSTKEPTGC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtacttaggcctcaatccatcctctgctaaacaatattctgctgtttttcag
cctattattcgcatagtccctttttcaaaacacgttcctcaaatacgacatgctaggaag
ttccttgtatcagcttcccatattttgttaacaagcccctcttctaccgcttgttttttt
tcttccattaggaaaagaatccctttatccctgttcaggaataaatccttcgttaccata
ggagaagcctcttcttctcgtgtaaaggcctttctccccaaagccaatattgtgcaaagc
gcattccctcaagcagaagcatttcttcccatcctatcgactcttccttccagctcctcc
ctactctatcctcactctgtactcgctcgtcccattctccgctctcttctacaaacactc
cctttctcctccttttcctatcctcattacacagttaaacccattacactttccgtaagt
acctttcttccccataaaactattattctcactagcccttctatcgttcgtgcctatgca
caactatttccctgcctccctgataaagaacactggtgtctaggagagattagtgcagca
gaattcaaacagatatttcacactcctccttccaaaattcttttttcaactaaagaaccg
acaggatgttga

DBGET integrated database retrieval system