KEGG   Chlamydia trachomatis L2/434/Bu: CTL0763Help
Entry
CTL0763           CDS       T00645                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
ctb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTL0763 (ruvA)
Enzymes [BR:ctb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CTL0763 (ruvA)
DNA repair and recombination proteins [BR:ctb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTL0763 (ruvA)
    RecFOR pathway proteins
     CTL0763 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 HHH IMS_HHH RuvA_C 5_3_exonuc HHH_8 HHH_3
Motif
Other DBs
NCBI-GeneID: 5857995
NCBI-ProteinID: YP_001654834
UniProt: B0B875
Position
complement(898703..899305)
Genome map
AA seq 200 aa AA seqDB search
MYEYIKGTLTHIDGSYVVIESFGIGYAIMLSERFLVDLRAFMHQEVLIYVHSVIRETEHV
LYGFSSRAERECFRLLISFSGIGPKTGLSILNMFPLQELCSIARLENVKAIASVPGIGKK
TAEKLMVDLKQKLPTLMPLYLEEPVVPSSTANSSFKEGIGALMNLGFSRLAADRMMTEAV
KELSEEASVAELLPIALRKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtatattaaaggcactttgactcatattgatgggtcttatgttgtgattgaa
agcttcggcataggatatgctattatgctttctgagcgttttttagtagatttgcgcgca
tttatgcatcaagaggtgctgatttatgttcatagcgtcattcgtgaaactgagcacgtt
ctatacggttttagctctcgcgctgaaagggagtgttttcgtttattaatttctttttct
ggtattggccctaaaacaggactatctattttaaatatgttccctttgcaagagttgtgt
tctattgcgcgcttagaaaatgtgaaagctattgcgtctgttcctgggatagggaaaaaa
acagcagaaaagctgatggtggatcttaaacaaaaacttcctactttgatgcccctttac
ttagaggaacccgtagttccttcctcgacagcgaattcttctttcaaagaaggaatcgga
gctctaatgaatcttgggttctctcgtcttgcagcagatcgtatgatgaccgaggctgta
aaagaattatctgaagaagcttcagtagccgaactgcttcctatagcattaagaaaaagc
tag

DBGET integrated database retrieval system