KEGG   Chlamydia trachomatis L2/434/Bu: CTL0763Help
Entry
CTL0763           CDS       T00645                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTL0763 (ruvA)
Enzymes [BR:ctb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CTL0763 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(898703..899305)
Genome map
AA seq 200 aa AA seqDB search
MYEYIKGTLTHIDGSYVVIESFGIGYAIMLSERFLVDLRAFMHQEVLIYVHSVIRETEHV
LYGFSSRAERECFRLLISFSGIGPKTGLSILNMFPLQELCSIARLENVKAIASVPGIGKK
TAEKLMVDLKQKLPTLMPLYLEEPVVPSSTANSSFKEGIGALMNLGFSRLAADRMMTEAV
KELSEEASVAELLPIALRKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtatattaaaggcactttgactcatattgatgggtcttatgttgtgattgaa
agcttcggcataggatatgctattatgctttctgagcgttttttagtagatttgcgcgca
tttatgcatcaagaggtgctgatttatgttcatagcgtcattcgtgaaactgagcacgtt
ctatacggttttagctctcgcgctgaaagggagtgttttcgtttattaatttctttttct
ggtattggccctaaaacaggactatctattttaaatatgttccctttgcaagagttgtgt
tctattgcgcgcttagaaaatgtgaaagctattgcgtctgttcctgggatagggaaaaaa
acagcagaaaagctgatggtggatcttaaacaaaaacttcctactttgatgcccctttac
ttagaggaacccgtagttccttcctcgacagcgaattcttctttcaaagaaggaatcgga
gctctaatgaatcttgggttctctcgtcttgcagcagatcgtatgatgaccgaggctgta
aaagaattatctgaagaagcttcagtagccgaactgcttcctatagcattaagaaaaagc
tag

DBGET integrated database retrieval system