KEGG   Chlamydia trachomatis L2/434/Bu: CTL0876Help
Entry
CTL0876           CDS       T00645                                 

Gene name
folA
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
ctb00670  One carbon pool by folate
ctb00790  Folate biosynthesis
ctb01100  Metabolic pathways
Module
ctb_M00840  Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTL0876 (folA)
   00670 One carbon pool by folate
    CTL0876 (folA)
Enzymes [BR:ctb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CTL0876 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 5858372
NCBI-ProteinID: YP_001654945
UniProt: A0A0H3MLJ3
Position
complement(1010381..1010860)
Genome map
AA seq 159 aa AA seqDB search
MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR
DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKK
YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc
aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat
cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg
gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt
gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt
gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaagaaa
tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt
tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system