KEGG   Chlamydia trachomatis L2/434/Bu: CTL0877Help
Entry
CTL0877           CDS       T00645                                 

Gene name
folP
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTL0877 (folP)
Enzymes [BR:ctb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CTL0877 (folP)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CTL0877 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1010857..1012209)
Genome map
AA seq 450 aa AA seqDB search
MTSWNFVCLSLGSNLGNRHEHIRRAYASLKKAGIRNLKSSVILETKALLLEGAPKEWDLP
YFNSVVIGETQLSPDELIEEIKMIESRFGQDASLKWGPRPIDIDVLFYGDEAFSYHSDKC
TIPHPKVLERPFILSMMASLCPYRRFRLEGSSCNGKTFAELAAIYPLTEEDALGSFGSAT
QIMGIVNITDNSISDTGLFLEASRAAAHAERLFAEGASIIDLGAQATNPRVKDLGSVEQE
WERLEPVLRLLAERWGAAQQCPDVSIDTFRPEIIRRAVEVFPIRWINDVSGGSLEMAHLA
KEFGLRLLINHSCSLPPRPDCVLSYEESPIEQMLRWGESQLEQFAQVGLDTSWQVVFDPG
IGFGKTPVQSMLLMDGVKQFKRVLECPVLIGHSRKSCLSMLGRFNSDDRDWETIGCSVSL
HDRGVDYLRVHQVEGNRRALAAAAWAGMFV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactagttggaattttgtttgtttaagtttgggttccaatttaggtaaccggcatgag
catataagacgcgcttatgcaagtttaaagaaggctgggatccgaaatttaaaaagttct
gtgattttagagacgaaggctttgttgttagaaggggctccgaaagaatgggatcttcct
tattttaactctgtagttattggggaaacgcagctatctccagacgagttgattgaagaa
atcaagatgatagaaagtcgttttggacaagatgcttctttaaaatgggggcctcgaccg
attgatattgatgtgcttttctatggagacgaagctttttcttatcatagtgacaaatgt
acaatcccacatcctaaggtattagaaagaccttttattctttctatgatggcttcttta
tgtccgtatcgtcgtttccgtttggaaggatcttcttgtaatgggaaaacgtttgcagag
cttgctgctatttatccattgacagaggaggatgcgttaggcagtttcggttctgctacc
caaattatgggtattgttaatattacggataactcgatctccgatacaggattgtttctg
gaggcgagcagagccgcagcccatgctgagagactctttgcagaaggagcttctattatt
gatttaggggcgcaagcaaccaatcctcgtgtaaaagatttaggaagcgtagaacaagag
tgggagcgtctagaacctgttttgcgtttattagcggagcggtggggggctgctcaacaa
tgccctgatgtatctatcgatacatttcgtccagagattattcgacgagctgttgaagta
tttccgattcgttggatcaatgatgtttctggaggctctttggaaatggctcatttggcg
aaggagtttgggctacggctattaataaatcattcgtgttcgctgcctccaagaccagat
tgtgtactttcttatgaagaatctcctattgagcaaatgttgcgttggggagagtctcag
ttagaacaatttgctcaagtaggtttagatacaagttggcaagttgttttcgatccagga
ataggatttgggaagactcccgttcagtcgatgttattgatggatggagtaaagcagttt
aaacgtgttttagagtgtcctgtattaataggccattctagaaaatcgtgtttgagtatg
ttgggccgatttaatagtgacgatcgtgattgggaaacgatcggctgttctgtatctctt
catgatcgaggagttgattatctacgtgtgcatcaggttgaaggtaacagacgtgcctta
gccgctgctgcttgggctggtatgtttgtatga

DBGET integrated database retrieval system