KEGG   Clostridium tetani E88: CTC00073Help
Entry
CTC00073          CDS       T00112                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ctc  Clostridium tetani E88
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ctc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(20790..21386)
Genome map
AA seq 198 aa AA seqDB search
MEFYPIAIEKLIEEFAKLPGIGKKTAQRLTLYVLNLPREEVEEFANALIKARGTIKYCSV
CGNFTDKDPCAICSNPNRDKNTICVVEHPKDIMTMEKVREYNGMYHVLHGTISPMAGRGP
NDIKLKELISRINGEIKEVIVATNPNVEGEATAMYISKILKPLGAKVTRIAHGIPVGGDL
EYADEVTLAKALEGRKEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggaattttatccaatagcaatagaaaaacttatagaagaatttgcaaagcttccaggc
atagggaagaaaacagctcagagactaactttatatgttttaaatttacctagagaagaa
gtagaggaatttgcaaatgctcttattaaagctagaggaacaataaagtattgttctgta
tgtggaaattttactgataaggacccttgtgctatatgtagtaatcctaatagggataag
aatactatatgtgtagtagaacatccaaaggatataatgactatggaaaaagtgagagaa
tataatggaatgtatcatgtattacatggcacaatttcaccaatggcaggaagaggtcct
aatgatataaagcttaaagaacttatttcaagaataaatggagaaataaaagaagtaatt
gtagctactaatcctaatgtggaaggggaagctacggctatgtatatatctaaaattttg
aagcctttaggagcaaaagttacaagaatagctcatggtataccagtaggtggagattta
gaatatgcagatgaggttactttagcaaaagctttagaaggtagaaaagaaatatag

DBGET integrated database retrieval system