KEGG   Clostridium tetani E88: CTC00230Help
Entry
CTC00230          CDS       T00112                                 

Definition
transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTC00230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTC00230
   00052 Galactose metabolism
    CTC00230
   00500 Starch and sucrose metabolism
    CTC00230
   00520 Amino sugar and nucleotide sugar metabolism
    CTC00230
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CTC00230
   00524 Butirosin and neomycin biosynthesis
    CTC00230
Enzymes [BR:ctc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CTC00230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197483..198436
Genome map
AA seq 317 aa AA seqDB search
MNKKYVVGIDLGGTTISGGVLDYEGNIVFRHTIDTKSELGEKIVLERIIKVIDYVIKKSK
IPKNNIKAIGIGSPGPLDIEKGIIITSPNLPFKNFNIVNPIKNHFKISVYLDNDANAAAV
GEYKFGSGKGSRNMIFITVSTGIGGGAILNGNIYRGSSSNALEIGHMTLKEDGAICNCGN
FGCAEALASGTAIAKKARMELNRGKESSLKKLKKISAYNVFQEAKNGDKLAQEIVDEALE
YLGICVSNIIITFDPDTIVIGGGVSKAGDIIFNKINQVVKERCFEAMWKNTKIIKALLLE
DAGIIGAASLAIFEESK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaaaagtatgtagtaggaatagacttaggtggtacaactataagcggaggagta
ttagattatgaaggaaatatagtttttagacatactatagatactaagtctgaacttgga
gagaaaattgtactagaaagaatcataaaagttatagattatgtaataaaaaaatcaaag
attcctaagaataatataaaagcaataggaattggatcaccaggacctttagatatagaa
aaaggaattattataactagtcccaatttaccatttaaaaattttaatatagttaatcca
ataaaaaatcattttaaaatctctgtttatttagataatgatgccaatgcggcagcagta
ggagagtataaatttggatctggaaaaggaagcagaaacatgatatttataactgtttct
acaggaataggtggaggagcaatattaaatgggaacatatatagaggtagtagttccaat
gctttagaaatagggcatatgactttaaaagaagatggagccatatgtaattgtggaaat
tttggatgtgcagaagcattggcatcgggcacagctatagctaaaaaagcaagaatggaa
ttgaatagaggaaaagaaagctcattgaaaaaactaaagaagatttcagcatataatgtt
tttcaagaagctaaaaatggagataaattagcacaagaaattgtagacgaggctttggag
tatttaggtatatgtgtttcaaacataattataacctttgatccagatactatagttata
ggtggaggggtatcaaaagctggagatataatatttaataaaataaaccaagttgtaaaa
gaaaggtgctttgaagctatgtggaaaaatactaaaataataaaagctttgttattagag
gatgcaggtattattggggcagcttcattagctatatttgaagaaagtaaataa

DBGET integrated database retrieval system