KEGG   Clostridium tetani E88: CTC00322Help
Entry
CTC00322          CDS       T00112                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctc  Clostridium tetani E88
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ctc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
304873..307104
Genome map
AA seq 743 aa AA seqDB search
MEEIQGTVDSIIFRNDENGYVVSRIKEDAKAITTIVGCIPYISEGQNLKLQGGWVIHPQF
GRQFKVESCEEIIPDTKKGIERYLASGVISGIGPVTAKKIVKEFGLETFDILENDIERLK
EIDGIGDKKINIIQEAYKDQKEVRNIMMFFQEYGISINHCLKIYKKFKGESIKIVKENPY
VLTENIAGIGFKTADKIARNLGVDVDSPFRIQSGVNYAVNQFSALGNTCMPIDKLIKEGK
EILNVKEEDIKENILQNAFQGKLRVEIVDGKEYVFSIPYYYCELGVTKNILKLSLYNHKD
LDMTVEEEIKKFEENNNIEFSPSQREAIMGAFLNGVEIITGGPGTGKTTIINCISEIYEN
YGYTVCMGAPTGRAAKRMTEATGRDAKTIHRLLEMGVGEEEVFSKTEETPLECDVVIIDE
ASMIDIMLMNNLLKAISIGTRLIIVGDVDQLPSVGPGNVLRDLIESNCVKIVRLKDIFRQ
SETSAITVNAHKINNGQMPVLNEREKDFFFLKGDSNEDILDVLLALVHKRLPNFNKDWDK
LKHIQILSPMRKGLLGVENLNKNLQMVLNPPSKDKKERKFKEYIFRVGDKIMQTKNNYNI
KWKKIDKYNREEGLGIFNGDIGYIEDIDEENNNMTIIFDEEKRVIYEDIFLDEIDLAYAI
TIHKSQGSEFPAVIIPTFMGPPMLMNRNLLYTGITRAKELVVVVGELKALKFMVDNNRSF
ERYSLLKWRIQNILENFYENDEQ
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaatacaaggtaccgttgattccataatatttaggaatgatgaaaatgggtat
gtagttagcagaattaaggaagatgctaaggctataacaactatagtaggatgcatacct
tatatatcagagggtcaaaacctaaaattacaggggggatgggttatacaccctcagttt
ggtcgacagtttaaagttgaaagctgtgaggaaattattccggatactaaaaaaggtatt
gaaagatatttggcttcaggagtaatttctggaataggaccggtaacagctaaaaagatt
gttaaggaatttggactagaaacctttgatattttagaaaatgatattgaaagattgaaa
gaaatagatggaataggcgataaaaaaataaatataattcaagaagcttacaaagatcaa
aaagaagttagaaatataatgatgttttttcaagagtatggaatatctataaaccattgt
cttaaaatatataaaaaatttaaaggggaatccattaaaatagtaaaagaaaatccatat
gtattaacggaaaatattgcaggtataggatttaaaacagcagataaaatagctagaaat
ttaggagttgatgtagattctccttttagaatacaaagtggtgtaaactatgcagttaat
caattttctgcattgggaaatacttgtatgccaatagataaactaataaaagaaggaaaa
gaaatattaaatgtaaaagaggaagatattaaagaaaacatattgcaaaatgcctttcaa
ggtaaattaagggtggagatagtggatggtaaagaatatgttttctctataccttactac
tattgtgaactaggagtaactaagaacatattaaagctatccttatataaccataaagat
ttagatatgactgtagaggaagagataaaaaaatttgaagaaaataataatatagaattt
tctccttcgcaaagagaagctataatgggagcgtttttaaatggagtggaaataataaca
ggtggacctggaacaggtaaaacaactataataaactgtatttctgagatatatgaaaat
tatggatatacggtttgtatgggggcccctacaggaagggctgccaaaagaatgactgaa
gctactggaagggatgcaaaaactatacacagattattggaaatgggagtaggagaagaa
gaagtattttctaaaacagaagaaacaccattagaatgtgatgtggtaataatagatgag
gcttcaatgatagatataatgcttatgaacaatctattaaaagctatatctataggaact
agacttataatagtgggagatgtagatcagttgccatcagtagggcctggaaatgtatta
agggatttaatagagagtaattgtgttaagatagttaggttaaaagacatatttagacaa
tcagaaactagtgcaataactgtaaatgctcataagataaataatggacaaatgcctgtt
ttaaacgaaagagaaaaagacttcttttttttaaaaggtgactccaatgaagatatatta
gatgttttattagcactagttcataaaagattaccaaattttaataaagactgggataaa
ttaaaacatatacaaatattgagtcctatgagaaaaggactattaggagttgaaaattta
aataaaaatcttcaaatggtgttaaatcccccatcaaaagataaaaaggagagaaaattt
aaggagtacatatttagagtaggggataagataatgcaaactaagaataattataatatt
aaatggaagaagatagacaaatataatagagaagaaggattgggaatattcaatggagat
ataggatatatagaggatatagacgaagaaaataataatatgaccattatttttgatgaa
gaaaagagagtaatttatgaagatatttttttagatgaaatagatttagcatatgccata
actatacataaaagtcaaggtagtgagtttccagcagttattatacctaccttcatggga
ccacctatgcttatgaatagaaatttactgtatacaggaataacaagagcaaaggaatta
gtagttgtagtaggagaattaaaggcattaaaatttatggtagataataatagaagcttt
gaaaggtattctttattaaagtggagaatacaaaacatattagaaaatttttatgaaaat
gatgaacaatag

DBGET integrated database retrieval system