KEGG   Clostridium tetani E88: CTC00380Help
Entry
CTC00380          CDS       T00112                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTC00380 (tpiA)
   01230 Biosynthesis of amino acids
    CTC00380 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTC00380 (tpiA)
   00051 Fructose and mannose metabolism
    CTC00380 (tpiA)
   00562 Inositol phosphate metabolism
    CTC00380 (tpiA)
Enzymes [BR:ctc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTC00380 (tpiA)
Exosome [BR:ctc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTC00380 (tpiA)
  Exosomal proteins of bladder cancer cells
   CTC00380 (tpiA)
  Exosomal proteins of melanoma cells
   CTC00380 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
369920..370687
Genome map
AA seq 255 aa AA seqDB search
MKGVYGLRKAIIAGNWKMHNTIDESVKLVEELIPKVKEAECEVVVCPPFICLPKIREITE
GTNIKVGAQNMYFEEKGAFTGEVSPLMLEKLNIDYVIIGHSERRQYFKETDQTVNKKLKA
AFEHNLIPILCVGETLDEKENGVTEEVVSKQVKLGLFELKEEQVEKLVIAYEPIWAIGTG
KTATSEEANEVIALIRSTVKSLYGDKVAESLRIQYGGSVKPSTIKEQMSMSDIDGALVGG
ASLKANDFSAIVNYK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggggtgtatggattgcgtaaagcaataatagcaggaaactggaaaatgcataat
actatagatgaatcagtgaaattagttgaggaattaattccgaaagttaaagaagcagaa
tgtgaagtagtagtttgtccaccttttatatgccttccaaagattagagaaattacagaa
ggaacaaatataaaagttggagctcagaatatgtatttcgaagagaaaggagcttttaca
ggagaggtatctcccctaatgcttgaaaagttaaatatagattatgtaataataggtcat
agtgaaagaagacaatattttaaagaaactgaccaaacagttaacaaaaagcttaaagca
gcctttgaacacaatttaattccaatactttgtgtaggagaaactttagatgaaaaagaa
aatggtgtaaccgaagaagttgtatcaaaacaagtaaaacttggtctttttgaattaaaa
gaagaacaagtagagaagctagtaatagcttatgaaccaatatgggctataggtacagga
aaaacagcaacctcagaggaggcaaatgaagttatagcacttataagaagtaccgtaaaa
agcctatatggagacaaagtggcagaaagcctaagaatacaatatggtggttcagtaaaa
ccttcaactataaaagaacaaatgtctatgtcagatatagacggagctttagtaggagga
gcaagtcttaaagcaaatgacttctcagctatagtaaactacaaatag

DBGET integrated database retrieval system