KEGG   Clostridium tetani E88: CTC00454Help
Entry
CTC00454          CDS       T00112                                 

Definition
phosphoglucomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTC00454
   00030 Pentose phosphate pathway
    CTC00454
   00051 Fructose and mannose metabolism
    CTC00454
   00052 Galactose metabolism
    CTC00454
   00500 Starch and sucrose metabolism
    CTC00454
   00520 Amino sugar and nucleotide sugar metabolism
    CTC00454
  Nucleotide metabolism
   00230 Purine metabolism
    CTC00454
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CTC00454
Enzymes [BR:ctc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CTC00454
    5.4.2.8  phosphomannomutase
     CTC00454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
452281..453636
Genome map
AA seq 451 aa AA seqDB search
MENINKSIFRKYDIRGIYGEEVTENFAELLGKTFGSFLIRKGEKKVIVGMDNRKSSPSIK
KSLIKGLTSTGVDVIDIGIVVTPIFYYATYLYKIKGGIMVTASHNPAKYNGFKIQFEEGT
IYGEKLLKLREEMVKGNFIKGNRYGYIIERSPVEEYIKNIEEKIKLGSKKLKVVVDCGNG
TAALFAPEILKRLGCDVISLYCTSDSDFPNHFPDPTVEDNLIDLIKKVRIEKADLGIAYD
GDGDRIGVVDEKGDIIWGDMLMILFWREILPKYPNIDAIVEVKCSNALVEEIRKLGGKPF
FYKTGHSLIKAKMQEIDAPFTGEMSGHMFFRDEYYGFDDALYASARLLRILSNTDKSLGE
LFYDIPQYFSTPEIRVPCKDEEKFERVERAKKYFEEKNMDIITIDGVRVNFENGWGLIRA
SNTGEELILRYESKNKNELKLIKRELRKALG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacataaataaaagcatctttaggaaatatgacataagaggaatatatggagaa
gaagtaacagaaaattttgcagaactattaggaaagacctttggaagttttttaataaga
aagggagagaaaaaagttatagtaggtatggataatagaaaatcctcacctagtattaaa
aagagtctaataaagggattaactagcacaggagtggatgttatagatataggaattgta
gtaacacccatattttattatgctacttatttatataaaataaaaggtggaataatggtt
acagccagccacaatccagcaaaatataatggattcaaaatacagtttgaagaaggcact
atatatggggaaaaacttttaaaattaagagaagagatggtaaaaggaaattttattaaa
ggaaatagatatgggtatataatagaaagatcccctgtagaagaatatattaaaaatata
gaagaaaaaataaaattagggtctaaaaaattaaaagtggttgtagattgcggtaatgga
acagcagctttatttgctccagaaattttaaaaagacttgggtgtgatgtaatatctcta
tattgcacttccgattcagattttcctaatcactttccagaccctacagtagaagataat
ttaatagatttaataaaaaaagtgagaatagaaaaggcggatttaggtatagcttatgat
ggagatggagacagaattggagtagtagacgaaaaaggagatataatttggggagatatg
cttatgatacttttttggagagaaatacttcctaaataccccaatatagatgctatagta
gaagtaaaatgttcaaatgctctagtagaagaaataagaaagctaggaggaaaacctttc
ttctacaaaacaggacattcacttataaaagctaaaatgcaggaaattgatgctcctttt
acaggagaaatgtctggtcatatgttttttagagatgaatattatggttttgatgatgct
ctttatgcctcagcacgacttttaagaattctatcaaatactgacaaaagtttaggagaa
cttttttatgatattcctcaatatttttccactccagagataagagtaccctgtaaggat
gaagaaaagtttgaaagggtagaaagggctaaaaagtactttgaagaaaaaaatatggac
ataataaccatagatggagttagggtcaactttgaaaatggatggggacttataagagca
tccaatacaggggaagagctaatattaagatatgagtcaaaaaataaaaatgaattaaaa
cttattaaaagagaacttagaaaagctttaggataa

DBGET integrated database retrieval system