KEGG   Clostridium tetani E88: CTC00570Help
Entry
CTC00570          CDS       T00112                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ctc  Clostridium tetani E88
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTC00570
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTC00570
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CTC00570
Enzymes [BR:ctc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CTC00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589152..590360
Genome map
AA seq 402 aa AA seqDB search
MKDFKLICTGCGETYSIKRVHPRCEKCNEPLEMELVKEGKIKDGNPLTQTILERYQDFFP
FDEINNELSLNEGFTSLVSSPRMAKRIGIKNIYFKNESQNPTWSFKDRGTLFGIHHAYSM
GYKKVGAVSTGNMAVSVAAYGQRAGFETFIFVGENIPEEKLNPVAIYGANLIKVEGDYGK
LYYESLEIGKDQGIYFINSDVTYRVEGYKTAAFEMCEQLNFNVPDYVVVPTSAGGNIRGI
LKGFKEFKEAGIIDRVPKMICAQASGCSPICNSFKEGKDEIERIMDPCTIAHGIENPFPP
SGNDTLRKIRENGGTCVAVTDEEIIKAQKEMAKEGIFVQPESCVPLASVKKLKIEGYLDE
NDSVACVLTGSGLKYTKAFEKHNLSSYECKLQVLETFIEENF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattttaaacttatatgtacaggttgtggagagacttattctataaaaagagtc
catccaagatgcgagaaatgtaatgaaccactagaaatggagcttgtaaaagaaggtaaa
ataaaagatgggaatccattaactcaaactatacttgaaaggtatcaggatttttttccc
tttgatgaaataaataatgaattatctttaaatgaaggatttacatctctagtgtcatct
ccaagaatggctaaaagaataggaataaagaatatatattttaaaaatgaaagtcaaaat
cctacatggtcttttaaagatagaggaacattgtttgggatacaccacgcttatagtatg
ggctacaagaaagtaggagcggtttcaactggaaatatggcggtatctgtagcagcttat
ggacaaagagcaggatttgaaacctttatttttgttggggaaaatataccagaagaaaaa
ttaaatcctgttgcaatatatggagccaatctaattaaagtagaaggagactatggaaaa
ctttattatgaaagtcttgaaataggtaaagatcaaggaatttattttataaactccgat
gttacatatagagttgaaggatacaagacagcagcttttgaaatgtgtgaacaattaaat
tttaatgttcctgattatgtggttgtaccaacaagtgcaggaggaaatataaggggtatc
cttaaaggattcaaggaatttaaggaggcaggaataattgatagagtacctaagatgata
tgtgctcaagcatcaggatgttcacctatttgtaattcttttaaagagggaaaagatgaa
atagaaagaataatggatccttgcactattgctcatggtatagaaaatccatttcctcca
agtggaaatgatactttaagaaagataagagaaaatggtgggacatgtgtagcggttaca
gatgaagaaataataaaggctcaaaaggaaatggcgaaagaaggaatatttgttcaacca
gaatcttgcgtgccattagcatctgtaaaaaagctaaagattgaaggatatttagatgag
aatgactcagtagcctgtgtattaacaggaagtggattaaaatacacaaaagcttttgaa
aaacacaatttatcttcatatgaatgtaaattacaagttttagaaacttttatagaagaa
aacttttaa

DBGET integrated database retrieval system