KEGG   Clostridium tetani E88: CTC00659Help
Entry
CTC00659          CDS       T00112                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ctc  Clostridium tetani E88
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTC00659
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CTC00659
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CTC00659
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CTC00659
Exosome [BR:ctc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTC00659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(677374..679029)
Genome map
AA seq 551 aa AA seqDB search
MFKSKRKKCITFLLLLAMTLNFLMVPNFNKVSASPSKVKNVILLVPDGTGITHTTLARWY
KGGEPLAMDEIACGLIRTYSSDAVIADSAPAATAMATGYKSHTGFISVLPDVANMPLLNP
IKKGEERRPVASILEGAKLNGMATGIVATCELPHATPASFASHYPNRKAYDTLSEQMVYN
DLDILFAGGHDVLIAEKRADKEDMLKILQSKGYDIVKDAEELKNTQAKKVWGLFAPMALD
YEFDRSYEQPSLSDMTQKAIDILSNGKKDGFFLMVEGSKIDWASHANDPIGVISDALAFD
NAVSVALNFAKKDKDTVVIVAPDHSNGGMTIGDSTLDKTYDNQPLSTIVAPLKRAKLTGE
GIGKKLNADRSNIKEIMSAYYGIDDLTAKEEQAIKTCDINKVIDTVGPMISKRAHIGWTT
KGHSGEEVGLYVYHPKGIRPTGVIQNTDVNKYMCEVLDINLQHVTDTLFLQAEKNFKEKE
ATLSVDSSDKENLVLIVTKDDKTVKFPQNKNIAIVGDETIELPGVTVYTGTKENIEIAKW
YLSDKAVNLIK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatctaagagaaaaaaatgtattacctttttattattattagctatgacatta
aattttttaatggtacctaactttaataaggtatcagcaagccctagtaaagttaaaaat
gttatcttattagttcctgatggcactggaataactcataccactctagcaagatggtat
aaaggtggagaacctcttgctatggatgaaattgcctgtggtcttattcgaacctattct
tccgatgcagttattgcagactcagctccagcagctactgccatggcaacaggttataaa
tcacacactggatttatttctgttctaccagatgtagcaaacatgcctctactaaatccc
ataaaaaaaggagaggaaagacgtcctgtggcttctatattagaaggtgctaaattaaat
ggaatggcaacaggtattgtagcaacttgtgaactacctcacgcaacccctgcaagtttt
gcttcccactatccaaatagaaaagcatatgatactttaagtgagcaaatggtatataat
gatttggatattttatttgcaggaggtcatgatgttttaattgctgaaaaaagagctgat
aaagaagatatgctcaagattttacaaagtaaaggatatgatattgttaaagatgcagaa
gaattaaaaaatactcaagctaaaaaggtttggggactttttgcacctatggctttagat
tatgagtttgatagatcttatgaacagccaagtctttctgatatgacccaaaaagctatt
gatattttatccaatggtaaaaaagatggttttttcttaatggtagaaggtagtaaaata
gattgggcttctcatgctaatgatccaataggagttattagtgatgctttagcctttgat
aacgcagtttcagtagcattaaattttgcaaagaaagataaagatactgtagtaatagtt
gctcctgaccacagtaatggtggcatgaccattggtgattcaactttagataaaacctat
gataatcaacctctttcaactatagtagcacctcttaaaagagcaaaacttacaggagaa
ggcataggtaaaaagctaaatgcagacagaagtaatataaaagaaattatgtcagcatat
tacggtatagatgatttaacagctaaagaagaacaagctataaaaacttgtgatattaat
aaagttattgatactgtaggtcctatgataagcaaaagagcccatataggttggactaca
aagggccattctggtgaagaagttggactatatgtttatcatccaaagggcataagacct
acaggagttattcaaaacactgatgttaacaaatatatgtgtgaagttttagatataaat
cttcaacatgttacagatacactattccttcaagctgaaaaaaactttaaagaaaaagag
gctaccctttctgtagattctagtgataaagaaaacttagtccttatagtaactaaagat
gataaaacagtaaagtttccacaaaataaaaatatagctattgttggagatgaaactata
gaattgcctggagttactgtttataccggcacaaaagagaatatagaaatagctaaatgg
tatttatctgataaagctgtaaatttaattaaataa

DBGET integrated database retrieval system