KEGG   Clostridium tetani E88: CTC00699Help
Entry
CTC00699          CDS       T00112                                 

Definition
nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ctc  Clostridium tetani E88
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CTC00699
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CTC00699
    3.5.1.-  
     CTC00699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
722086..722661
Genome map
AA seq 191 aa AA seqDB search
MEVDNLSKAIIVVDCQNDFISGSLACHMGKESVDNIISLINSNKDFKVFYSCDWHSKNNK
SFKANGGIWPIHCVGYEEGAELHQNFYKNIENEKQSPLNKENIFYKGQDDEIEEYSAFYA
KNSKGEILNNKIPKEVIVCGIASEYCVRETIKEFLEYDFTVSLFLDGLGYVNKEEHNKNI
EELKKLDVNII
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgataatttgagtaaggctataatagtggtagattgtcaaaatgattttata
agtggaagcttagcttgtcatatgggtaaagaatctgtagataatataataagtttaatt
aatagcaataaagattttaaggtgttttattcctgtgattggcatagtaaaaataataaa
tcatttaaagcaaatggcggtatatggcctattcattgtgtgggatatgaggaaggggca
gaattgcatcaaaacttttataaaaatatagaaaatgaaaaacagagtccattgaataaa
gaaaatattttttataagggacaggatgatgaaatagaagagtattctgctttttatgct
aaaaattctaaaggagaaatcctcaacaacaaaattcccaaggaagtaatagtttgtgga
atagcatctgaatactgcgtaagagagactataaaggaatttttagaatatgatttcacg
gttagtttatttttagatggattgggatatgtaaataaagaagagcataataaaaatata
gaagagttaaaaaaattagatgtaaatataatttag

DBGET integrated database retrieval system