KEGG   Clostridium tetani E88: CTC00699Help
Entry
CTC00699          CDS       T00112                                 

Definition
nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ctc  Clostridium tetani E88
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ctc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
722086..722661
Genome map
AA seq 191 aa AA seqDB search
MEVDNLSKAIIVVDCQNDFISGSLACHMGKESVDNIISLINSNKDFKVFYSCDWHSKNNK
SFKANGGIWPIHCVGYEEGAELHQNFYKNIENEKQSPLNKENIFYKGQDDEIEEYSAFYA
KNSKGEILNNKIPKEVIVCGIASEYCVRETIKEFLEYDFTVSLFLDGLGYVNKEEHNKNI
EELKKLDVNII
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgataatttgagtaaggctataatagtggtagattgtcaaaatgattttata
agtggaagcttagcttgtcatatgggtaaagaatctgtagataatataataagtttaatt
aatagcaataaagattttaaggtgttttattcctgtgattggcatagtaaaaataataaa
tcatttaaagcaaatggcggtatatggcctattcattgtgtgggatatgaggaaggggca
gaattgcatcaaaacttttataaaaatatagaaaatgaaaaacagagtccattgaataaa
gaaaatattttttataagggacaggatgatgaaatagaagagtattctgctttttatgct
aaaaattctaaaggagaaatcctcaacaacaaaattcccaaggaagtaatagtttgtgga
atagcatctgaatactgcgtaagagagactataaaggaatttttagaatatgatttcacg
gttagtttatttttagatggattgggatatgtaaataaagaagagcataataaaaatata
gaagagttaaaaaaattagatgtaaatataatttag

DBGET integrated database retrieval system