KEGG   Clostridium tetani E88: CTC00812Help
Entry
CTC00812          CDS       T00112                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ctc  Clostridium tetani E88
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CTC00812
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CTC00812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859128..860060
Genome map
AA seq 310 aa AA seqDB search
MIENMKEEFFFYSKDNTRIYCTKYIPKDKLKGVVQIIHGMGENSSRYEHLAMKFIGNGYA
VYMHDHRGHGKTAEVRENLGHLGNGDVFLKMIYDMKEVTDIIKSQLGEVPVFLLGHSMGS
FLSQKYISLFGKELKGVILMGTDGRKGRILDIGIALSRKEIKKHGSKHKSKKLNRICFLN
CHLAFIPNRTKFDWLSSDTEEVDKFIEDDFLGFYYDNLFFYYFFKGLKDIHKKSVMNKIP
KNLPIYICGGSKDPIGRNGKGLLNLYNMYKNMGIKSLTCKIYENGRHEILNEKNKDNVME
DIIIWINRHV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaatatgaaagaagaattctttttttacagcaaagataatactagaatatat
tgcactaaatacattcctaaggataagttaaaaggagtagttcaaataattcatggcatg
ggggaaaatagtagtagatatgaacatttagctatgaaatttataggaaatggatatgct
gtatatatgcatgatcatagaggacatggtaaaacagcagaagtaagagaaaacttaggg
catctaggaaatggagatgtattcttaaaaatgatatatgatatgaaagaagttactgac
ataataaaaagtcaattaggagaagtgcctgtatttttattggggcatagtatgggatct
tttttatcccaaaaatatatttcgctttttggtaaggagctaaaaggggtaatacttatg
ggaacagacggaaggaaaggaagaattttagatataggcattgcactttctagaaaagaa
ataaaaaaacatggtagtaagcataaaagtaagaaattaaatagaatatgttttttaaat
tgtcatttagcttttattccaaatagaactaagtttgattggctaagtagtgatacagag
gaagtagataaatttatagaagatgattttttaggattttattatgataatttatttttt
tattacttttttaaaggattaaaagatatacataaaaaaagtgtaatgaataaaatacca
aagaatcttccaatatatatatgtggaggctcaaaagaccctataggaaggaatggaaaa
gggcttttaaatttatataatatgtataaaaacatgggtatcaaaagtttaacttgtaaa
atatatgaaaatggaagacatgaaatattaaatgaaaaaaataaagacaatgttatggaa
gatataataatctggataaataggcatgtataa

DBGET integrated database retrieval system