KEGG   Clostridium tetani E88: CTC01733Help
Entry
CTC01733          CDS       T00112                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ctc  Clostridium tetani E88
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CTC01733
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CTC01733
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CTC01733
Two-component system [BR:ctc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CTC01733
Bacterial motility proteins [BR:ctc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CTC01733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1844867..1845658)
Genome map
AA seq 263 aa AA seqDB search
MECLGNGAFDFLPKPSGSISLDIDKVKDDLITKINLAHKKCEIVCSREDIKKDPRKIKLV
KSTLNNKKIEAVVIGASTGGPKALYEVITKLPKNLGVPIFVVQHMPPTFTKAFADRLNNN
SNLKVVEAAEGEIIEENVVYIAQGGYHMEINNSKISLNKEETLWGVRPAVDKLFFSAAKT
YKDKLLSIVLTGMGKDGAQGTVEVKKNGGITISEDESTCTIYGMPKSTFDTGKVDMVLPI
HEISDAIIKIVEGRGNGYGFRKI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtttagggaatggagcttttgattttttacctaagccttcgggatctatatca
ttagatatagataaagttaaagatgatttaataactaaaataaatttagcacataaaaaa
tgtgaaattgtatgctcaagggaagatattaaaaaggatccaagaaaaattaaattagta
aaaagcaccttaaataacaagaaaatagaagcagtggtaataggggcttctactggagga
ccaaaagcgctttacgaagtaataacgaaacttccaaagaatttaggtgttcctatcttt
gtagtacagcatatgcctccaaccttcacaaaagcatttgcagatagattaaataataac
agtaatttaaaagtggtagaagcagctgaaggagaaataatagaagaaaatgtggtatac
attgcccaaggaggatatcatatggaaataaataattctaagatatctctaaataaggaa
gaaaccttatggggtgtaagacctgctgtagataaactctttttttcagctgcaaaaact
tataaagataaattattaagtatagtattaacaggtatgggaaaggacggagctcaaggt
acagtggaagtaaagaaaaatggaggaataaccatatccgaagatgaatctacatgtaca
atatacggaatgccaaaatcaacttttgatacagggaaggtggacatggttttaccaata
catgaaatttcagatgctataataaaaatagtagaaggaagaggaaatggatatggattt
agaaaaatttaa

DBGET integrated database retrieval system