KEGG   Clostridium tetani E88: CTC01733Help
Entry
CTC01733          CDS       T00112                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ctc  Clostridium tetani E88
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ctc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ctc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(1844867..1845658)
Genome map
AA seq 263 aa AA seqDB search
MECLGNGAFDFLPKPSGSISLDIDKVKDDLITKINLAHKKCEIVCSREDIKKDPRKIKLV
KSTLNNKKIEAVVIGASTGGPKALYEVITKLPKNLGVPIFVVQHMPPTFTKAFADRLNNN
SNLKVVEAAEGEIIEENVVYIAQGGYHMEINNSKISLNKEETLWGVRPAVDKLFFSAAKT
YKDKLLSIVLTGMGKDGAQGTVEVKKNGGITISEDESTCTIYGMPKSTFDTGKVDMVLPI
HEISDAIIKIVEGRGNGYGFRKI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtttagggaatggagcttttgattttttacctaagccttcgggatctatatca
ttagatatagataaagttaaagatgatttaataactaaaataaatttagcacataaaaaa
tgtgaaattgtatgctcaagggaagatattaaaaaggatccaagaaaaattaaattagta
aaaagcaccttaaataacaagaaaatagaagcagtggtaataggggcttctactggagga
ccaaaagcgctttacgaagtaataacgaaacttccaaagaatttaggtgttcctatcttt
gtagtacagcatatgcctccaaccttcacaaaagcatttgcagatagattaaataataac
agtaatttaaaagtggtagaagcagctgaaggagaaataatagaagaaaatgtggtatac
attgcccaaggaggatatcatatggaaataaataattctaagatatctctaaataaggaa
gaaaccttatggggtgtaagacctgctgtagataaactctttttttcagctgcaaaaact
tataaagataaattattaagtatagtattaacaggtatgggaaaggacggagctcaaggt
acagtggaagtaaagaaaaatggaggaataaccatatccgaagatgaatctacatgtaca
atatacggaatgccaaaatcaacttttgatacagggaaggtggacatggttttaccaata
catgaaatttcagatgctataataaaaatagtagaaggaagaggaaatggatatggattt
agaaaaatttaa

DBGET integrated database retrieval system