KEGG   Clostridium tetani E88: CTC01763Help
Entry
CTC01763          CDS       T00112                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ctc  Clostridium tetani E88
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTC01763
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CTC01763
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CTC01763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1874307..1875203
Genome map
AA seq 298 aa AA seqDB search
MNINLIGVPLFYGSDIEGVEFGPKKLREKNIVEVLSKYHRVYDFGDLYVPEENSLNKYSY
HPKMKYLKPIIQVNTNLAQEVYASLSSKSFPLILGGDHSLALGSISGVSKYYKNFAVIWV
DAHGDINSYLTTHTGNVHGMPLAAAMGVGYNDLTNLYFHGTKVKPENVFIIGARDLDEGE
CELIEEKNLNVYSTEDIKYKGISYVLEDILSKLDAQGIDAIHLSFDIDCIDPDFVPGTGT
PVKDGLSTGEAKTLLKSLCESRLIKSMDFVELNPRLDKDDSTSNLCIELLDWCFKYIK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaatttaattggtgttccattattctatggttccgatattgaaggagtagaa
tttggtcctaaaaaattaagagaaaaaaatatagtagaggttttaagtaaatatcatagg
gtatacgattttggtgatttatatgttccggaggaaaactcactaaataaatattcctat
catccaaaaatgaaatatttaaaaccaataattcaggtaaataccaatttagctcaggag
gtatatgcttctcttagttctaaaagtttccctcttatattaggcggagatcattcatta
gcccttggaagtatttctggtgttagtaaatactataaaaattttgcagtaatatgggta
gatgctcatggagatataaactcttacttaactactcatactggaaatgtgcatggtatg
cctcttgcagctgccatgggtgttggatataatgacctaacaaatctttatttccacggt
accaaagttaaaccagaaaatgtatttataataggtgctagagatttagatgagggtgaa
tgtgaactaatagaagagaaaaatttaaatgtatattccactgaggacattaaatataaa
ggtatctcctatgtactggaagatattctttctaaattggatgctcaggggattgatgct
atacatttaagttttgatatagattgtatagatccagactttgttcctggtacaggtaca
cctgtaaaagatggactttctacaggtgaggctaaaaccttattaaaatccttatgtgaa
agtagattaattaaatctatggattttgttgaattaaatcctagattggataaagatgat
agtacatctaatctatgtattgaactgctagactggtgttttaagtatatcaaataa

DBGET integrated database retrieval system