KEGG   Clostridium tetani E88: CTC02158Help
Entry
CTC02158          CDS       T00112                                 

Definition
anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ctc  Clostridium tetani E88
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ctc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ctc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
2287150..2288367
Genome map
AA seq 405 aa AA seqDB search
MKKFNLFIVLLLINFAFLLGCGKNNNSNNRNINNETSKAPKLNNDNSMQVKLNSMSLDEK
IGQLLIVGFDGYEANKNIESLIKKNYVGGVILFGNNIRSAEQTMKLTNSLKSINSKNKIP
LFISVDEEGGRVSRMPKELEKLPSNKIIGEINNSNLSYNIGKIISKELTCLGFNMNFAPI
LDINSNLQNPVIGDRSFGNNPNLVTRLGIKTMEGLREGNIIPVIKHFPGHGDTSVDSHVG
LPLINHDMKRLKEFELIPFKEAINNNADVVMISHILLPKIDSSYPATMSKIIIKDVLRND
LKFNGVVITDDMTMSAITKNFDISNAAIKSINAGTDIILICHGYDNEIYVINSIKEAVEN
NIITEDKINESVYRILKLKEKYKISNDTVDNIDVDKINSEIKSIF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaatttaatttatttatagttttattattaataaattttgcatttttactaggc
tgtggtaaaaataataactctaataatagaaatattaataatgaaacttccaaagctcca
aaactaaataatgataactctatgcaagttaaacttaatagtatgagcttagatgagaaa
attggtcaactgcttattgtaggttttgatggatatgaagcaaataagaatatagaaagt
ttaattaaaaaaaattacgttggtggtgttattttatttggaaacaatataagaagtgca
gaacaaacaatgaaattaactaattcattaaaatctattaattcaaagaataaaattcca
ttatttatatctgttgatgaagaaggtggacgggttagcagaatgcctaaagaattagaa
aaacttcctagtaataagattataggtgaaataaataatagtaaccttagttataatata
ggcaaaataatttcaaaagaacttacatgccttggatttaatatgaattttgcaccgatt
ctagatataaatagtaacctgcaaaatcctgtaattggggatagatcctttggtaataat
ccaaatttagttactagacttggtattaaaactatggaaggattaagagagggtaatatt
attcctgttataaaacattttccaggacatggtgatacctcagtggattctcatgtggga
cttcctttaattaatcatgatatgaaaagattaaaggagttcgaattaatcccctttaaa
gaggcgataaataataatgcagatgtagttatgatatctcatatattgttacctaaaata
gactcctcctatcctgcaactatgtcaaaaatcataataaaagatgttttacgaaatgat
ttaaagtttaatggagtggttattacagatgatatgaccatgagtgccattacaaaaaat
tttgatatttctaatgcagctattaaatctataaatgctggaacggatattattttaata
tgtcatggctatgataatgaaatatacgtaattaattctataaaagaagcagtagaaaac
aatataataacggaagataaaattaatgaaagtgtttatagaatactaaaattaaaggaa
aagtataaaataagtaacgatacagtggataatatagatgttgacaaaataaatagtgaa
attaaaagtattttttaa

DBGET integrated database retrieval system