KEGG   Clostridium tetani E88: CTC02212Help
Entry
CTC02212          CDS       T00112                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ctc  Clostridium tetani E88
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTC02212 (ruvA)
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CTC02212 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2334417..2335010)
Genome map
AA seq 197 aa AA seqDB search
MYDYIKGIYKGMHKDYITVENNGIGYKIFTSGNTLYETPEKDEEIKLYIQQIPRDDSINL
YGFFTEEERDMFNLLMTISGVGAKSSLSLLSVTSINKLKYSIVTEDTTLLTRAPGIGRKT
AERIILELKDKFKNDDIISDIDDLDSISNFQLHSAEALEALMSLGYSQKESEKALKNVDK
ENSLEDIIKACLKYLMG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgactacataaaaggaatatataaagggatgcataaagattacataacagtagaa
aataatggcataggatataaaatatttacttcaggcaacactttatatgaaactcctgaa
aaggatgaagaaataaaattgtatattcaacaaataccaagagatgattccataaattta
tatggattttttacagaagaagaaagggacatgtttaatttattaatgactataagcgga
gtgggtgctaagtcatctttatctttactttctgtaaccagtattaataaattaaaatat
tcaattgtaacagaagatacaactcttttaacaagggcaccaggaattggaaggaagacg
gcggagagaataatattagaattaaaagataaatttaaaaatgatgatataatttcagat
attgatgatttggatagtataagtaactttcaattgcattctgcggaagctttagaagct
ttaatgtctcttggatattctcaaaaagaatcagagaaggcattaaaaaatgtggataaa
gaaaatagcctagaagacataataaaggcatgcttaaaatatttaatgggatga

DBGET integrated database retrieval system