KEGG   Clostridium tetani E88: CTC02358Help
Entry
CTC02358          CDS       T00112                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ctc  Clostridium tetani E88
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTC02358
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTC02358
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CTC02358
Enzymes [BR:ctc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CTC02358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2498043..2499536)
Genome map
AA seq 497 aa AA seqDB search
MIQLKLSYKSTRSETNINSSEAIVQGIADKGGLFVPTSFPKIDIPFSQLKDFDYKRLAIY
ILKKFLTDFSEEELNGYVEKAYDQKFENKSIVPIVKKEDVYFLELYHGPTLAFKDMALSI
LPYLLKASLKKNKIEKEVVILTATSGDTGKAALEGFADVDDTKIIVFYPEHGVSPIQKKQ
MSTQKGENTYVIGVNGNFDEAQNSIKEIFNDEVLEESIEKKGYIFSSANSINIGRLIPQI
VYYVYSYMWLLKKGEIEEGEEINIVVPTGNFGNILAAYYSKKMGIPVNKFICASNENNVL
CEFFNKGIYDKNKEFKITSSPSMDILISSNLERLIYEICDGNEDKVKTYMDKLKYGGTYE
LDKEELEKLNSFYSSFATDEETYEKLKEVYDKYSYLMDTHTAVAYKVYEDYKKDTGDKRK
SIIASTASPFKFTRDVAKALKINDEKLDDFQLIYKISEYTGVMVPKTIEKLYKEEIIHNR
KCEKEDIKNVIKEILKV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgatacagttgaagttatcctataaaagtactagatcagaaacaaatataaattcaagt
gaagcaatagtacaaggtatagcagataagggtggattatttgtgccaacatcctttcct
aaaatagatatacctttttctcaattaaaagattttgattataaaagattagctatttat
atattaaaaaaatttctaactgatttttcagaagaagaattaaatggatatgtggaaaaa
gcatatgatcaaaaatttgaaaataagtctatagttcctatagtaaaaaaagaagatgta
tactttttagagctatatcatgggccaaccttagcatttaaagatatggcattatccata
ttaccatatttattaaaagcctctttaaaaaagaataaaatagaaaaagaggttgttata
ttaacagctacttctggtgatacaggcaaagcagcactagaaggttttgctgatgtagat
gatacaaaaattatagtgttttacccagaacatggtgtaagtccaatacaaaaaaaacag
atgagtactcaaaaaggggaaaatacttatgttataggtgtcaatggaaattttgatgag
gcacaaaatagtataaaagaaatatttaatgatgaagtattagaagagagtatagagaaa
aaaggatacatattttcttctgccaactccataaatataggaagattaattcctcaaata
gtttattatgtttattcatatatgtggcttttgaaaaaaggagaaatagaggaaggagaa
gaaatcaacatagtagtacctacaggtaattttggtaatatattagcggcatactatagt
aaaaaaatggggataccagtaaataagtttatatgtgcatcaaatgaaaataatgtgctt
tgtgaattttttaataaaggaatctatgataaaaataaagaatttaaaataacttcttct
ccatcaatggatatattaatatctagtaacttagaaagattaatttatgaaatatgtgat
ggaaatgaggataaagtaaaaacatatatggataaactaaaatatggtggaacatatgaa
ctagataaagaggagttggagaaattaaatagtttttattcaagttttgcaacagatgaa
gaaacctatgaaaaacttaaagaagtatatgataaatactcatatcttatggatactcac
actgcagtagcatataaagtttatgaggattataagaaggatacaggggataagagaaaa
tctataatagcttctacagcaagtccatttaaattcactagggatgtagctaaggcgcta
aagataaatgatgaaaaactagatgattttcaattaatttataaaatatctgaatatacg
ggagttatggtacctaaaactatagaaaaactttataaagaagaaataatacataataga
aaatgtgaaaaagaagatataaaaaatgttataaaagaaattttaaaagtatag

DBGET integrated database retrieval system