KEGG   Clostridium tetani E88: CTC02462Help
Entry
CTC02462          CDS       T00112                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ctc  Clostridium tetani E88
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ctc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2613637..2615118)
Genome map
AA seq 493 aa AA seqDB search
MEEYIMVLDQGSTRSKCILFDKKGEVLGESEREVEPIYPKLGWMEYNPVNIWASQFSVTT
ELLAKYNISIEKIASIGITNQRETVLVWDKRTGIPVYNAIAWQCRRTVEISEELNKKGYG
KVIKEKTGLVLDPYFSATKIKWILDNVEGARKEAERGNLAFGTMDSWLIWNLTKGEKHMT
DYSNASRTMLFNIHTLQWDEELLEIFQIPKSMLPEVGPSSHVYGHTDSILFGKEVPIGGV
AGDQNSSLFGQTAFEEGAAKNTYGTGCFMLMNTGNKPINSQKGLITTIAWGLDGEVTYAL
EGSVFMAGEGINWIKDNLRMIDSLEDAEEYALSVEDTNNVYMVPAFGGLGAPYWNPEAKG
VVIGLTRGSKKEHFIRAVIESLAYQSYDVLKAMEEDSGIVLKNLRVDGQYSVNNFLMQFQ
SDILNCKVEKPKNILNIAGLGAAYFAGLAVGFWKNKEDILKNNGIEKEFNSSIDDRRRKV
LVEGWKEAIKRTI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatatattatggtattagatcagggaagtacaagatctaagtgcatactattt
gataaaaaaggtgaagtgttaggagaaagtgaaagagaggtagaacccatatatcctaaa
ctaggatggatggaatataatcctgttaatatatgggcaagtcagttctctgtaactaca
gaattattagcaaaatacaatatttcaatagaaaaaatagcttccattggaattacaaat
caaagggaaacggtattggtgtgggataagagaacaggaatcccagtatataatgcaatt
gcttggcaatgtagaagaacagtagaaattagtgaagaacttaataaaaaaggatatggt
aaagttataaaagaaaaaacaggattagtactagatccttatttttcagctaccaaaata
aagtggatattagataatgtagaaggagctagaaaagaagcagaaagaggtaatttagcc
tttggtactatggattcttggcttatatggaatttgacaaaaggtgaaaaacatatgaca
gattatagtaatgcttcaagaactatgttatttaatatacacacattgcagtgggatgaa
gaacttctagaaattttccaaatacctaaatccatgctacctgaagtgggaccatcaagt
cacgtttatggacatacagacagtattttgtttggaaaagaagtacctataggaggagta
gcaggagaccaaaattcatctctttttggacaaaccgcctttgaagaaggggcagctaaa
aatacctatggcacaggatgttttatgcttatgaatacaggaaataaacccataaattca
caaaaaggacttataacaactatcgcttggggattagatggtgaagttacttatgcccta
gaaggttcagtttttatggctggagaaggtataaattggattaaagataatttgagaatg
atagattcattggaggatgctgaagaatatgcgttatcagtggaggacactaataatgta
tatatggttccagcctttggaggattaggagcaccatattggaatccagaagctaagggt
gtagttataggtcttacaagaggaagcaagaaggagcattttataagagcggttatagaa
tctctggcatatcaaagttatgatgttttaaaagctatggaggaagattcaggtatagtt
ttaaagaatttaagagtagatgggcaatattctgtaaataattttttaatgcaatttcaa
tcagatatattaaattgtaaagttgaaaagcctaaaaatattttaaatatagcaggttta
ggtgccgcatattttgcaggattagctgttggtttttggaaaaacaaagaagatatttta
aagaataatggtatagaaaaagaatttaacagtagtattgatgatagaagaagaaaagtt
cttgtagaaggttggaaggaagctatcaaaagaactatataa

DBGET integrated database retrieval system