KEGG   Clostridium tetani E88: CTC02490Help
Entry
CTC02490          CDS       T00112                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTC02490 (pfkA)
   01230 Biosynthesis of amino acids
    CTC02490 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTC02490 (pfkA)
   00030 Pentose phosphate pathway
    CTC02490 (pfkA)
   00051 Fructose and mannose metabolism
    CTC02490 (pfkA)
   00052 Galactose metabolism
    CTC02490 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CTC02490 (pfkA)
Enzymes [BR:ctc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTC02490 (pfkA)
Protein phosphatases and associated proteins [BR:ctc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTC02490 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2642339..2643298)
Genome map
AA seq 319 aa AA seqDB search
MRKIAVLTSGGDAPGMNAAIRAVVRTGLDKGITVLGIERGFDGLLNGEIFEMTRRSVADI
IQRGGTILRTARSEEFKTEEGQKKATDILRVFGVEGLVVIGGDGSFQGAKSLSELGVKTI
GIPGTIDNDLAYTDYTIGFDTAVNTVLDAINKLRDTSTSHGRASVVEVMGRNCGDIALYA
GLAGGAESIIVPELRFDIDKLCKTILEGKKNGKMHNLIIVAEGAGKANDIAKTIEKVTGV
GTRATVLGHIQRGGSPTANDRILASRMGNRAVELLLEEKSSRVVGINDNRIVDMDIHEAL
SIEGKFDEKLYEIAKALSY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagctgttttaacaagcggaggagatgcacctggaatgaatgcagccata
agagctgtagtaagaacaggtttagataaaggaataacggtattaggaatagagagaggt
tttgatggtcttttaaatggagaaatatttgaaatgacgagaagaagtgtagcagacata
attcaaagaggtggaactatactaagaacggctaggtccgaagaatttaaaacagaagag
ggtcagaaaaaggccactgatatattaagagtatttggagtagaggggttagttgtaatt
ggaggagatgggtcttttcaaggagcaaaatccttatctgaattaggggtaaaaactata
ggtataccaggaaccatagacaatgatttagcttacacagattatacaataggatttgat
actgctgttaatactgtgttagatgccataaataaattaagagatacttctacatctcat
ggtagagctagtgtagtggaggtaatgggaagaaattgtggtgatatagcattatacgca
ggtctagctggtggtgctgaaagtataattgttccagaattaaggtttgatatagacaaa
ttatgtaaaactatattagaaggtaagaaaaacgggaaaatgcacaatctaataatagta
gcagaaggagcaggaaaagctaatgatatagctaaaacaattgaaaaggtaaccggtgtt
ggaacaagagctactgttttaggacacatacaaagaggaggaagccctacagctaacgat
agaatattagcctcaagaatgggaaacagggcagtagaattattgttggaagaaaagtcc
tctagggtagttggaataaatgataatagaattgtggatatggatatacatgaggcttta
tctattgaaggtaaatttgatgagaaactatatgaaatagctaaggctttatcatattaa

DBGET integrated database retrieval system