KEGG   Clostridium tetani E88: CTC02525Help
Entry
CTC02525          CDS       T00112                                 

Gene name
porB
Definition
pyruvate synthase subunit porB (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTC02525 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTC02525 (porB)
   00020 Citrate cycle (TCA cycle)
    CTC02525 (porB)
   00620 Pyruvate metabolism
    CTC02525 (porB)
   00640 Propanoate metabolism
    CTC02525 (porB)
   00650 Butanoate metabolism
    CTC02525 (porB)
  Energy metabolism
   00680 Methane metabolism
    CTC02525 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTC02525 (porB)
Enzymes [BR:ctc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTC02525 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2682604..2683554)
Genome map
AA seq 316 aa AA seqDB search
MATLKELTHIPDRITSGHRMCAGCGAPMVVKWVMKAVKPENKVVVSNATGCLEVSTTLYP
YSAWKDSFIHTAFENAAATMSGVEAAYKNLKGKGKVKDNYKFIAFGGDGGTYDIGFQSLS
GAMERGHDMLYVCYDNGAYMNTGIQRSSATPAGADTTTSPKGKQSSGKTQFSKDLTMIMA
SHNIPYVAQTVPVIPGTKYTLDLYNKSNRAINEIKGAKFINVIAPCPRGWRCDTATELEA
IKLAVETCYWPLYEVINGEFKLSYKPKNKLPIEEWLKVQGRFSHLLKSEEGRGKIEEIQK
EIDRRWEKLLFLCEEK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaacattaaaagaattaacacatataccagatagaataactagtggacatagaatg
tgtgcaggctgtggggcacctatggtagtaaagtgggttatgaaagctgtaaaaccagaa
aataaagtagtagtatctaatgctacaggatgtttagaagtttcaactactttatatcct
tactctgcatggaaggattcctttattcatacagcctttgaaaatgcagcggcaacaatg
agtggagtagaagctgcttataagaatttaaaaggtaagggcaaagtaaaagataattat
aaatttatagcctttggtggagatggaggaacttatgatataggatttcagtctttatct
ggtgctatggaacgaggacatgatatgctttatgtttgttatgataatggagcatatatg
aatacgggaatacaaagatcatcagcaacgccagcgggagcagacactacaacaagtcca
aagggaaaacaatcttctggtaaaactcaatttagtaaagatttaactatgataatggca
tcgcataatataccctatgtagctcagacagttcctgtaatacctggcactaaatatact
ctagatctttacaataaatcaaatagagccataaatgaaattaaaggagctaagtttata
aatgttatagcaccatgtccaaggggatggagatgtgatactgcaacggaattggaagca
ataaaactggcagttgaaacttgctattggccattatacgaagttattaatggagagttt
aaattaagctataaaccaaaaaataaattacctatagaagaatggcttaaagttcaaggc
agattctctcatttacttaaatcagaagagggaagaggaaaaattgaagaaatccaaaaa
gaaatagatagaagatgggaaaaattattatttctttgtgaagaaaaataa

DBGET integrated database retrieval system