KEGG   Clostridium tetani E88: CTC02526Help
Entry
CTC02526          CDS       T00112                                 

Gene name
porA
Definition
pyruvate synthase subunit porA (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTC02526 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTC02526 (porA)
   00020 Citrate cycle (TCA cycle)
    CTC02526 (porA)
   00620 Pyruvate metabolism
    CTC02526 (porA)
   00640 Propanoate metabolism
    CTC02526 (porA)
   00650 Butanoate metabolism
    CTC02526 (porA)
  Energy metabolism
   00680 Methane metabolism
    CTC02526 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTC02526 (porA)
Enzymes [BR:ctc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTC02526 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2683566..2684756)
Genome map
AA seq 396 aa AA seqDB search
MLKDNQIRKSLSGNEAVAIAMKQIEPDVVAAFPITPFTEVPQYFSTFVAEGKCNTEFVPV
ESEHSAMSACVGASSAGARVMTATSSNGLGLMWEMLHIAAGDRCPIILALVNRAMSPPLN
IHNDHSDSMGARDAGWIQIYSENTQEAYDNFIQIVKVAENEKVMVPAMVCYDGFITSHAV
ENVTLLEDSAVKEFVGENKRVNDGLLGEDSMAVGPMVLTDFYMEMKRSQLQGLLNAKEVL
LEVSKEYEKLTGRKYGLFEEYKLSDADIAMVIIGSSAGTGKKVVDDLREKGIKAGLLKIR
LYRPFPGKEIAKALKNVKALAVMDKAEGLSGNGGPIFTDVSAAIYGELKDAILMSYIYGL
GGRDVRVEDLEKVFMELKEAMETGNYDKYNYLSLRE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggataatcagataagaaagagtttaagtggtaatgaagcagtagctatagct
atgaaacaaatagagcctgatgtggtagcagcgtttccaataactccattcacagaagta
cctcaatatttttctacctttgtagctgaaggaaaatgtaatactgagtttgtacctgta
gaatcagaacatagtgctatgagtgcatgtgtaggggcatcatcagcaggggcgagagta
atgacggctacatcctcaaatgggttaggattaatgtgggaaatgcttcatatagcagca
ggagacagatgtcctataattcttgccctagtaaatagagctatgtcaccaccacttaat
atacacaatgatcactcagattccatgggtgctagagatgctggatggatacagatatat
tctgaaaatactcaagaagcttatgataactttatacaaattgttaaagttgcagagaat
gagaaggttatggtaccagcaatggtttgttatgatgggtttataactagccatgctgtt
gagaatgtaactttactagaagattcagcagttaaagaatttgttggagaaaacaaaaga
gtcaatgatggactgctaggggaagatagtatggcagttggaccaatggttttaacagat
ttctacatggaaatgaagagaagtcagctacaaggactattaaatgcaaaggaagtttta
cttgaagtaagtaaagaatatgaaaagttaacaggtagaaagtatggtttatttgaagaa
tataaactttcagatgcagatatagccatggttattataggatcttctgcaggaactggt
aaaaaggttgtagatgatcttagagaaaaaggtattaaagcagggctactaaaaataagg
ttatatagacctttcccaggaaaggaaattgctaaagctttaaagaatgtaaaagcttta
gcagtaatggacaaggctgagggattatctggaaatgggggtcctatttttacagatgta
tcagcagcaatatatggagagttaaaagatgctattttaatgagttatatatatggttta
ggtggaagagatgttagagttgaggatttagaaaaagtgtttatggagctaaaggaagct
atggaaacaggaaattatgataaatataactatttatctttaagagagtag

DBGET integrated database retrieval system