KEGG   Clostridium tetani E88: CTC02526Help
Entry
CTC02526          CDS       T00112                                 

Gene name
porA
Definition
pyruvate synthase subunit porA (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:ctc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ctc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ctc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ctc00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ctc00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:ctc00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:ctc00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2683566..2684756)
Genome map
AA seq 396 aa AA seqDB search
MLKDNQIRKSLSGNEAVAIAMKQIEPDVVAAFPITPFTEVPQYFSTFVAEGKCNTEFVPV
ESEHSAMSACVGASSAGARVMTATSSNGLGLMWEMLHIAAGDRCPIILALVNRAMSPPLN
IHNDHSDSMGARDAGWIQIYSENTQEAYDNFIQIVKVAENEKVMVPAMVCYDGFITSHAV
ENVTLLEDSAVKEFVGENKRVNDGLLGEDSMAVGPMVLTDFYMEMKRSQLQGLLNAKEVL
LEVSKEYEKLTGRKYGLFEEYKLSDADIAMVIIGSSAGTGKKVVDDLREKGIKAGLLKIR
LYRPFPGKEIAKALKNVKALAVMDKAEGLSGNGGPIFTDVSAAIYGELKDAILMSYIYGL
GGRDVRVEDLEKVFMELKEAMETGNYDKYNYLSLRE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggataatcagataagaaagagtttaagtggtaatgaagcagtagctatagct
atgaaacaaatagagcctgatgtggtagcagcgtttccaataactccattcacagaagta
cctcaatatttttctacctttgtagctgaaggaaaatgtaatactgagtttgtacctgta
gaatcagaacatagtgctatgagtgcatgtgtaggggcatcatcagcaggggcgagagta
atgacggctacatcctcaaatgggttaggattaatgtgggaaatgcttcatatagcagca
ggagacagatgtcctataattcttgccctagtaaatagagctatgtcaccaccacttaat
atacacaatgatcactcagattccatgggtgctagagatgctggatggatacagatatat
tctgaaaatactcaagaagcttatgataactttatacaaattgttaaagttgcagagaat
gagaaggttatggtaccagcaatggtttgttatgatgggtttataactagccatgctgtt
gagaatgtaactttactagaagattcagcagttaaagaatttgttggagaaaacaaaaga
gtcaatgatggactgctaggggaagatagtatggcagttggaccaatggttttaacagat
ttctacatggaaatgaagagaagtcagctacaaggactattaaatgcaaaggaagtttta
cttgaagtaagtaaagaatatgaaaagttaacaggtagaaagtatggtttatttgaagaa
tataaactttcagatgcagatatagccatggttattataggatcttctgcaggaactggt
aaaaaggttgtagatgatcttagagaaaaaggtattaaagcagggctactaaaaataagg
ttatatagacctttcccaggaaaggaaattgctaaagctttaaagaatgtaaaagcttta
gcagtaatggacaaggctgagggattatctggaaatgggggtcctatttttacagatgta
tcagcagcaatatatggagagttaaaagatgctattttaatgagttatatatatggttta
ggtggaagagatgttagagttgaggatttagaaaaagtgtttatggagctaaaggaagct
atggaaacaggaaattatgataaatataactatttatctttaagagagtag

DBGET integrated database retrieval system