KEGG   Clostridium tetani E88: CTC02528Help
Entry
CTC02528          CDS       T00112                                 

Gene name
porC
Definition
pyruvate synthase subunit porC (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
ctc  Clostridium tetani E88
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTC02528 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTC02528 (porC)
   00020 Citrate cycle (TCA cycle)
    CTC02528 (porC)
   00620 Pyruvate metabolism
    CTC02528 (porC)
   00640 Propanoate metabolism
    CTC02528 (porC)
   00650 Butanoate metabolism
    CTC02528 (porC)
  Energy metabolism
   00680 Methane metabolism
    CTC02528 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTC02528 (porC)
Enzymes [BR:ctc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTC02528 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2685064..2685648)
Genome map
AA seq 194 aa AA seqDB search
MDKKLMEIRWHGRGGQGAKTASLLLAEAAFNAGMYIQGFPEYGPERMGAPITAYNRISNF
PLRVHSNIYEPDYVVVVDETLLKTGVCTKGLKKEGGIIVNTKKTPNEIRKELDGYEGKVY
TINARKISEEALGAYFPNTPMLGAIVRVTNIIDIDKFIGDMEGSFKHKFESKPHFIPKNM
EALKRGIQEVNGIE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaactaatggaaattagatggcatggacgaggaggacagggtgcaaaaacc
gcatcactattattagctgaagctgcatttaatgctggaatgtatatacaaggttttcca
gagtatggtccagagagaatgggagcacctataacagcctacaataggatttctaatttc
cctctaagagttcatagcaatatttatgaaccagattatgtagttgtagtagatgaaact
ttacttaaaacaggagtatgtacaaaaggtctaaaaaaagaaggaggaattattgtaaat
actaaaaaaactcctaatgaaataagaaaagagctagatggatatgaaggaaaagtatat
acaataaatgcaagaaagatatcagaagaagctctaggagcatattttcctaacacacct
atgctaggggcaatagtaagggtaacaaatattatagatatagataaatttattggggac
atggaaggatcttttaaacataaatttgaaagtaagcctcatttcatacctaagaatatg
gaagcgttaaaaagaggtattcaggaggtgaatggaattgagtaa

DBGET integrated database retrieval system