KEGG   Chlamydia trachomatis RC-F/69: CTRC69_04675Help
Entry
CTRC69_04675      CDS       T02763                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ctcf  Chlamydia trachomatis RC-F/69
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ctcf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1024371..1026587
Genome map
AA seq 738 aa AA seqDB search
MDPFFLNTQHVELLVSGKQSSPQDLLGIVSESLNQDRIVLFRPGAETVFVELRGKIQQAE
SHHSGIFSLPVMKGISPQDYRVYHQNGLLAHDPYAFPLLWGEIDSFLFHEGTHQRIYERM
GAIPCEIDGVPGVRFIVWAPHAQRVSVIGDFNGWHGLVNPLHKVSDQGVWELFVPGLTAG
ACYKWEMVTESGQVLIKSDPYGKFFGPPPRSVSVVIDDSYEWNDSEWLEERIKKTEGPMN
IYEVHVGSWQWQEGQPLNYKELADQLALYCKQMHYTHVELLPVTEHPLNESWGYQTTGYY
APTSRYGSFEDLQYFIDTMHQHGIGVILDWVPGHFPIDSFAMSGFDGTPLYEYTRNPSPL
HPHWHTYTFDYAKPEVCNFLLGSALFWIDKMHVDGIRVDAVSSMLYLDYGRYAGEWVPNR
YGGRENLDAIRFLQQFNTVIHEKYPGVLTFAEESTTFPKITVSVEEGGLGFDYKWNMGWM
HDTLHYFEKDFPYRPYHQSDLTFPQWYAFSERFLLPFSHDEVVHGKRSLIGKMPGDAWRQ
FAQLRLLLGYQICQPGKKLLFMGGEFGQGREWSPGRELDWELLDISYHQGVHLCSQELNA
LYVQSPQLWQADHLPSSFRWVDFSDVRNGVVAYLRFADADAKKALLCVHHFGVGYFPHYL
LPILPLESCDLLMNTDNTRFGGSGKGFREPEILTPEIARQEREAAGLIEADDESGPDCWG
LDIELPPSATLIFSVTLQ
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
gtggatccttttttcttaaatactcaacacgtggaacttctcgtttctggtaaacagagc
agtccacaagatcttttgggaattgtttctgaaagtttgaatcaagatcggatagttctt
ttccgccctggggcagagaccgtttttgttgagttgcgaggtaagattcaacaggcagag
tcgcaccattcagggattttttctcttcctgtaatgaaaggaatttctccccaagattat
cgagtctatcatcaaaatggtttattggctcatgatccttatgccttccctttactttgg
ggggaaatcgattcttttttattccatgaagggactcatcagcgtatctatgaacgcatg
ggtgctatcccttgtgaaattgatggagtacctggagtaagatttattgtttgggcccct
catgctcaacgtgtttctgttattggagattttaatgggtggcatgggctcgttaatcct
cttcataaggtttcagatcaaggagtttgggagctgtttgttcctggccttacagcagga
gcttgttacaaatgggaaatggtcacagaatctgggcaggttctcattaaatcggatcct
tatgggaagttttttggtcctcctcctcggagcgtttccgttgttatcgatgattcttat
gaatggaacgatagcgagtggttagaagagcgcattaaaaagactgaaggccctatgaat
atctatgaagttcatgtagggtcttggcaatggcaggaaggacaacctttgaattataaa
gagctagcagatcagctagctctctattgcaagcagatgcattatacgcatgtagagttg
cttcccgtaaccgagcatcctttgaatgaatcttggggatatcaaacaacgggatattat
gctcctacaagtcgttatggctcttttgaagatttacagtattttatagataccatgcat
cagcatggtatcggggtgattttagattgggttccaggacacttccctatagattcattt
gcaatgagtggttttgatggcactcctctgtatgaatatacacggaatccgagtccgttg
catcctcactggcacacctacacttttgattatgctaaaccggaagtgtgcaattttctt
ttaggaagtgcgctcttttggatcgataaaatgcatgtagatggtattcgtgtggatgct
gtctcatctatgctttatttagattatggaagatatgctggagaatgggttccaaatcgt
tatggtggaagagagaaccttgatgcgattcggtttcttcagcaattcaacactgtgatt
catgagaaatatccaggtgttttgactttcgcagaggagtcgacaaccttccctaagatt
actgtatctgtcgaagaagggggattagggtttgattacaaatggaatatgggatggatg
catgatacactgcattatttcgagaaggatttcccatatcgtccttatcaccagagcgat
ctcactttcccacaatggtatgcttttagtgagaggtttttactgcctttttcccatgat
gaggttgttcatgggaaacgcagtttaatcggtaagatgcctggagatgcttggagacag
tttgctcagttgcgtttattattaggttatcagatctgtcaaccaggaaagaaattgctt
ttcatggggggagagttcggtcaggggagagagtggtcccccggtcgtgagctagactgg
gaattattagatatttcttatcatcaaggtgtgcatttgtgttcgcaagagctaaatgct
ttatatgtgcagagcccgcaactgtggcaagcggaccatcttccctcctctttccgttgg
gtcgattttagtgatgtgcgtaatggcgttgttgcttatctccgctttgcagacgcggat
gctaagaaagctttgctttgcgtgcatcattttggggtaggatactttcctcattactta
cttcccatactccccctagaatcttgtgatttgctgatgaatacagataacacaagattc
gggggatcggggaaaggttttcgagagcctgaaatccttacacctgaaatcgcgagacaa
gagagagaggctgcaggactgatcgaagcggatgatgaaagtggtcccgactgctggggc
ttagatattgagctgcctccttcagctactctgattttctctgtaacgctacagtag

DBGET integrated database retrieval system