KEGG   Chlamydia trachomatis D-EC: CTDEC_0071Help
Entry
CTDEC_0071        CDS       T01900                                 

Gene name
yaeM
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTDEC_0071 (yaeM)
Enzymes [BR:ctd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CTDEC_0071 (yaeM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83807..84946
Genome map
AA seq 379 aa AA seqDB search
MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAYGRNQEALISQIREFNPRVVAVREE
TTYKELRKLFPHIEILLGEEGLVSVATEPSVTMTIVASSGIDALPAVIAAIRQKKTIALA
NKESLVAAGELVTTLARENGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNK
SKEELQKVSLQEVLRHPVWNMGPKITVDSSTLVNKGLEIIEAFWLFGLEAVEIEAVIHPQ
SLVHGMVEFCDGTILSVMNPPSMLFPIQHVLTFPERSPAIGPGFDFLSNRTLEFFPIDED
RFPSVHLAKRVLLEKGSMGCFFNGANEALVHRFLAGEISWHQIVPKLQALVDQHRVQSCL
SLEEILSVDAEARARAQEC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcatttagcactgatagggtcaacagggagtattggtagacaggttttacaagta
gttcgttctattcccgatacttttattatagaaactcttgctgcgtatggacggaatcaa
gaagcattgatttctcagattagagagtttaatcctcgcgtggtagccgttcgtgaagaa
acaacttacaaggagctccgtaagttattccctcatattgagattcttttaggagaagag
gggttagtttctgttgctacagaaccttctgtaacaatgaccattgtagcttcgtctggt
atagatgctttaccagcagtcattgcagctatccgacagaaaaagacaatagctttggct
aataaagagtcgttagtggcagctggagagttggttaccactttggctagagagaatggt
gtgcagattcttcccatcgatagtgaacataacgcacttttccagtgcttagaaggaaga
gactcttctaccattaaaaaattattgttaacagcttctggagggccgttaaggaataaa
tcaaaagaagaattacaaaaggtctctttacaagaggtcttgcgacaccctgtttggaat
atggggcccaaaattacagtagattcttctaccttagtaaataaaggcttagaaattata
gaagctttctggctatttgggctggaagctgtagagatagaggcggtgatccatcctcaa
agtcttgttcatggaatggtggagttttgtgatggaacgatcctttctgtgatgaatcct
cccagtatgctatttccaatacaacatgttttgactttcccagaacgtagccctgcaata
ggtccaggattcgattttctttcaaatcgcactctagagtttttcccgatagatgaagat
agattccctagtgttcatctagcaaagcgagtgcttcttgaaaaggggtctatggggtgt
tttttcaatggcgccaatgaggctttggttcatcgatttttagcaggcgagatttcttgg
catcaaatagttcctaaattacaagctcttgtggatcagcatcgcgtgcaatcctgttta
tccctggaagaaattctatcggtagatgctgaggccagagctcgtgctcaagagtgttaa

DBGET integrated database retrieval system