KEGG   Chlamydia trachomatis D-EC: CTDEC_0328Help
Entry
CTDEC_0328        CDS       T01900                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTDEC_0328 (tpiA)
   01230 Biosynthesis of amino acids
    CTDEC_0328 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTDEC_0328 (tpiA)
   00051 Fructose and mannose metabolism
    CTDEC_0328 (tpiA)
   00562 Inositol phosphate metabolism
    CTDEC_0328 (tpiA)
Enzymes [BR:ctd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTDEC_0328 (tpiA)
Exosome [BR:ctd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTDEC_0328 (tpiA)
  Exosomal proteins of bladder cancer cells
   CTDEC_0328 (tpiA)
  Exosomal proteins of melanoma cells
   CTDEC_0328 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
369333..370157
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFISSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTTGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLSLCPDVNGLLVGGASLSSENFLSIIQQIDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaaaacacttactgaa
gctcagacctttttaaaaagtttcatctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaagctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaagctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactctagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactacaggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcactttccctctgccctgatgttaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaaatcgatatcccataa

DBGET integrated database retrieval system