KEGG   Chlamydia trachomatis D-EC: CTDEC_0328Help
Entry
CTDEC_0328        CDS       T01900                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
ctd00010  Glycolysis / Gluconeogenesis
ctd00051  Fructose and mannose metabolism
ctd01100  Metabolic pathways
ctd01110  Biosynthesis of secondary metabolites
ctd01120  Microbial metabolism in diverse environments
ctd01130  Biosynthesis of antibiotics
ctd01200  Carbon metabolism
ctd01230  Biosynthesis of amino acids
Module
ctd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTDEC_0328 (tpiA)
   00051 Fructose and mannose metabolism
    CTDEC_0328 (tpiA)
   00562 Inositol phosphate metabolism
    CTDEC_0328 (tpiA)
Enzymes [BR:ctd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTDEC_0328 (tpiA)
Exosome [BR:ctd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTDEC_0328 (tpiA)
  Exosomal proteins of bladder cancer cells
   CTDEC_0328 (tpiA)
  Exosomal proteins of melanoma cells
   CTDEC_0328 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI51004
Position
369333..370157
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFISSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTTGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLSLCPDVNGLLVGGASLSSENFLSIIQQIDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaaaacacttactgaa
gctcagacctttttaaaaagtttcatctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaagctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaagctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactctagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactacaggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcactttccctctgccctgatgttaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaaatcgatatcccataa

DBGET integrated database retrieval system