KEGG   Chlamydia trachomatis D-EC: CTDEC_0633Help
Entry
CTDEC_0633        CDS       T01900                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTDEC_0633 (hemB)
Enzymes [BR:ctd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CTDEC_0633 (hemB)
Exosome [BR:ctd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTDEC_0633 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
720261..721289
Genome map
AA seq 342 aa AA seqDB search
MYNFMIRLPLLKRPRRNRKSAAVRSIIQETQLCSSDLIWPIFLKDGSGIREEIKSMPGVY
RWSLDMVSKELERLCTIGLKAVILFPVIDANKKEQFGSYASHPYNIVCKGIQAIKKSFPE
LCVISDIALDPFTTSGHDGIFHNNYVINDESVRVYGGIAVMHAEMGADIVAPSDMMDGRV
KHIREQMDQMGFVNTGILSYSAKYASALYGPFRDALSSHLQSGDKRTYQMDPANVQEALL
ECQLDEEEGADMVMIKPAGFYLDVIVKARENTHLPVVAYQVSGEFSMIMAACLHGWLNKE
SVIKESLLAIKRAGATAIISYATPWVLEWLAKDALPFERSVL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaactttatgataaggcttccattactaaaacgacctcgcagaaaccgaaaaagt
gcagccgttcgatctataattcaagaaacccaactctgttctagtgacttgatctggccc
atctttcttaaagatggctctggaattcgagaagaaataaagagtatgcctggagtatac
agatggagtttagacatggtctctaaagagttagagagactttgtacgataggattgaaa
gctgttatcctctttcctgtaattgatgctaataaaaaagaacaatttggatcctatgcg
tcgcatccttacaacattgtttgtaaagggattcaagcgataaaaaaatcttttccagaa
ttatgtgtcatcagtgacatagctttagatccttttacaaccagtggtcacgatgggatt
tttcataataactacgttatcaatgatgaaagtgtccgtgtatatgggggtatcgctgtc
atgcatgcggaaatgggagcagatattgttgctcctagcgatatgatggatgggagagtg
aagcatattcgagagcagatggatcagatggggtttgtcaacacgggtattctctcgtac
agtgcaaaatatgcatctgcattgtatggcccatttcgggatgctctttcttcacatctt
cagtctggagataagcgtacatatcaaatggatcctgccaatgttcaagaagcgttgcta
gagtgtcagttagatgaagaagaaggcgctgatatggtgatgataaaacccgcaggtttt
tatctagatgtaatcgttaaagcgagagaaaacacccatcttccggtggtagcctatcaa
gtcagcggggaattttctatgattatggctgcttgccttcatgggtggttaaacaaagaa
agtgtaataaaagaatctttattagcgattaagagagctggtgcaacagctataattagt
tacgcaacaccatgggttttagaatggctagctaaagatgctcttccctttgagagaagt
gttctttga

DBGET integrated database retrieval system