KEGG   Chlamydia trachomatis D-EC: CTDEC_0722Help
Entry
CTDEC_0722        CDS       T01900                                 

Gene name
pgm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTDEC_0722 (pgm)
   01230 Biosynthesis of amino acids
    CTDEC_0722 (pgm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTDEC_0722 (pgm)
  Energy metabolism
   00680 Methane metabolism
    CTDEC_0722 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTDEC_0722 (pgm)
Enzymes [BR:ctd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTDEC_0722 (pgm)
Exosome [BR:ctd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTDEC_0722 (pgm)
  Exosomal proteins of melanoma cells
   CTDEC_0722 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(833863..834552)
Genome map
AA seq 229 aa AA seqDB search
MLSMTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLV
RSLITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQG
KNKQEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFIS
AHGNSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgctctctatgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaa
aatctgtttacaggctgggtagacatccctcttagccaacaaggaattcaagaggctatt
gccgctggagaatctattaaacatcttcctattgattgcatcttcacttccaccttggtt
agaagtttgataacagccctgttagcaatgactaaccacagctctcaaaaagttccttat
atcgttcatgaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcag
atgatccctctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaagga
aaaaataaacaagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccga
agctaccgcattgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctc
ccctattttcaagagagaattttccctctccttcagcaagggaaaaatatttttatctct
gctcacgggaattctttgcgctccttaattatggacctagaaaaattatctgaagaacaa
gtactctctttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaa
ttcacgaaacacgctccttctcttggttaa

DBGET integrated database retrieval system