KEGG   Chlamydia trachomatis D-EC: CTDEC_0722Help
Entry
CTDEC_0722        CDS       T01900                                 

Gene name
pgm
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
ctd00010  Glycolysis / Gluconeogenesis
ctd00260  Glycine, serine and threonine metabolism
ctd00680  Methane metabolism
ctd01100  Metabolic pathways
ctd01110  Biosynthesis of secondary metabolites
ctd01120  Microbial metabolism in diverse environments
ctd01130  Biosynthesis of antibiotics
ctd01200  Carbon metabolism
ctd01230  Biosynthesis of amino acids
Module
ctd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTDEC_0722 (pgm)
  Energy metabolism
   00680 Methane metabolism
    CTDEC_0722 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTDEC_0722 (pgm)
Enzymes [BR:ctd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTDEC_0722 (pgm)
Membrane trafficking [BR:ctd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTDEC_0722 (pgm)
Exosome [BR:ctd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTDEC_0722 (pgm)
  Exosomal proteins of melanoma cells
   CTDEC_0722 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADI51399
Position
complement(833863..834552)
Genome map
AA seq 229 aa AA seqDB search
MLSMTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLV
RSLITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQG
KNKQEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFIS
AHGNSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgctctctatgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaa
aatctgtttacaggctgggtagacatccctcttagccaacaaggaattcaagaggctatt
gccgctggagaatctattaaacatcttcctattgattgcatcttcacttccaccttggtt
agaagtttgataacagccctgttagcaatgactaaccacagctctcaaaaagttccttat
atcgttcatgaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcag
atgatccctctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaagga
aaaaataaacaagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccga
agctaccgcattgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctc
ccctattttcaagagagaattttccctctccttcagcaagggaaaaatatttttatctct
gctcacgggaattctttgcgctccttaattatggacctagaaaaattatctgaagaacaa
gtactctctttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaa
ttcacgaaacacgctccttctcttggttaa

DBGET integrated database retrieval system