KEGG   Chlamydia trachomatis D-EC: CTDEC_0774Help
Entry
CTDEC_0774        CDS       T01900                                 

Gene name
cysQ
Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
ctd00920  Sulfur metabolism
ctd01100  Metabolic pathways
ctd01120  Microbial metabolism in diverse environments
ctd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CTDEC_0774 (cysQ)
Enzymes [BR:ctd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CTDEC_0774 (cysQ)
Transfer RNA biogenesis [BR:ctd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CTDEC_0774 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P zf-BED
Motif
Other DBs
NCBI-ProteinID: ADI51449
Position
complement(907626..908690)
Genome map
AA seq 354 aa AA seqDB search
MIVTSLQPAEKLMFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPAD
YAIQYYFYQKLTSLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQDLYQALSP
ESSHSSLFWLTDPIDGTSGFIKQRCFAIALSLFYEHTPVLSVIACPSSENNSFKIYSAAK
GEGLTICNPTHSFPFSLHEDFQPTCKFCEASLSARNHQHLTTHILSKHLPWNPQPIRADS
QCKYAWVADNTVDFFIRIPYSPPRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLY
LDRHPLILASANEQMHSTILETLYKLRHQATQNMLPLATHISATKHKQLSALQL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttacctctttgcaaccagcggaaaagcttatgttctccctcctcaatgactgc
caaaaagctgcggaaacagttgtcatgcaggctatgctgtcactgatgcgctatcgaaaa
gctcataaatttattcccttttggaaaaagcctgaccagacatacgttactcccgctgat
tacgctatccaatattatttttaccaaaaactgacatctttatttccgcatatcccgctg
gtcggagaagaaactctcaatcctgccacggatcaccctaggatccctcaaatcctacaa
tttgcgcagcagctcgatcccaaagtctcctgtcaagatttgtatcaggccctctctccg
gaaagctcccactcttcactattttggttaacggaccctatcgacggtacttcgggattc
atcaaacaacgttgtttcgccatcgctctttctctattttacgaacatactcctgttctc
tccgttatcgcttgcccttcttctgaaaataactctttcaaaatctattcggcagccaaa
ggcgaaggacttacgatttgtaatcctacccattccttccccttctccctgcacgaagat
ttccaacctacctgtaaattctgtgaagcctccttatcagctagaaaccatcaacattta
actacacatattctcagtaaacatctcccttggaatcctcagcctatccgagcagatagt
caatgcaaatacgcttgggttgcagataatacggtagacttcttcattcgcatcccgtat
tcccctccacgagcccactacagagaccatgctcccggtgtgtttcttatagaagaagct
ggaggcctcgttacagatatatcggggaatcctctccctttttctaatccaaatttatat
ctagatagacatcctttgattcttgcttctgctaacgagcaaatgcatagcacgatttta
gagactctatacaaactacgtcaccaagctactcaaaacatgctcccccttgccactcat
atctctgctactaagcataaacagctaagcgctcttcaactatag

DBGET integrated database retrieval system