KEGG   Chlamydia trachomatis D-EC: CTDEC_0774Help
Entry
CTDEC_0774        CDS       T01900                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ctd00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(907626..908690)
Genome map
AA seq 354 aa AA seqDB search
MIVTSLQPAEKLMFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPAD
YAIQYYFYQKLTSLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQDLYQALSP
ESSHSSLFWLTDPIDGTSGFIKQRCFAIALSLFYEHTPVLSVIACPSSENNSFKIYSAAK
GEGLTICNPTHSFPFSLHEDFQPTCKFCEASLSARNHQHLTTHILSKHLPWNPQPIRADS
QCKYAWVADNTVDFFIRIPYSPPRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLY
LDRHPLILASANEQMHSTILETLYKLRHQATQNMLPLATHISATKHKQLSALQL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttacctctttgcaaccagcggaaaagcttatgttctccctcctcaatgactgc
caaaaagctgcggaaacagttgtcatgcaggctatgctgtcactgatgcgctatcgaaaa
gctcataaatttattcccttttggaaaaagcctgaccagacatacgttactcccgctgat
tacgctatccaatattatttttaccaaaaactgacatctttatttccgcatatcccgctg
gtcggagaagaaactctcaatcctgccacggatcaccctaggatccctcaaatcctacaa
tttgcgcagcagctcgatcccaaagtctcctgtcaagatttgtatcaggccctctctccg
gaaagctcccactcttcactattttggttaacggaccctatcgacggtacttcgggattc
atcaaacaacgttgtttcgccatcgctctttctctattttacgaacatactcctgttctc
tccgttatcgcttgcccttcttctgaaaataactctttcaaaatctattcggcagccaaa
ggcgaaggacttacgatttgtaatcctacccattccttccccttctccctgcacgaagat
ttccaacctacctgtaaattctgtgaagcctccttatcagctagaaaccatcaacattta
actacacatattctcagtaaacatctcccttggaatcctcagcctatccgagcagatagt
caatgcaaatacgcttgggttgcagataatacggtagacttcttcattcgcatcccgtat
tcccctccacgagcccactacagagaccatgctcccggtgtgtttcttatagaagaagct
ggaggcctcgttacagatatatcggggaatcctctccctttttctaatccaaatttatat
ctagatagacatcctttgattcttgcttctgctaacgagcaaatgcatagcacgatttta
gagactctatacaaactacgtcaccaagctactcaaaacatgctcccccttgccactcat
atctctgctactaagcataaacagctaagcgctcttcaactatag

DBGET integrated database retrieval system