KEGG   Chlorobium tepidum: CT0090Help
Entry
CT0090            CDS       T00088                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cte  Chlorobium tepidum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CT0090
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CT0090
Enzymes [BR:cte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CT0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
85187..86305
Genome map
AA seq 372 aa AA seqDB search
MKATLLAALLLFLSFTSALAAPSTPDSLSIKIGQMLMIGFRGMEAKDDSAIAADIRERGI
GGVVLFDYDVPSKSPIRNIESPEQLRRLTSELQKLSTTPLFIAVDQEGGRVCRLKPSRGF
PPTVSAAYLGTLNNSDSTWQAAGSTAALLKSLGINVNLAPVVDLNVNPSNPVIGKLDRSF
SADPVVVAQQARMVIDAFHQQGIIAALKHFPGHGSSTTDTHKDFTDVTATWSKKELDPYW
ALIREGYSDPVMTAHVFNARLDSLYPATLSKATIDGLLRKQLGFRGVVLSDDMQMKAIAD
RYGLEEAIRLAIDAGVDVLIFGNNVSYDPEIASKATSIIRHLVEKGAISPERINESYRRI
MTLKTRTIISRP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgactctccttgcggcgctgctgctttttttgagctttacctccgcgctggcc
gcgccatccacgcccgacagtctttcgatcaagatcggccagatgcttatgatcggcttc
cgtggcatggaggccaaagacgattcagctatcgccgctgatattcgcgagcggggcatc
ggcggcgtggtgctgttcgattacgacgtgccatcaaaatctccaattcgcaacatcgag
tcgccggagcagctccggcgtcttacctcggagctgcaaaagctctcgaccactccgctt
ttcattgctgtcgatcaggagggtgggcgcgtctgccgcctcaagccgtcgcgcggcttt
ccgccgaccgtttccgccgcttatctcggcacactcaataattccgacagcacatggcag
gccgccggatcgaccgccgctttactcaaaagtctcggtatcaacgtgaatctcgcgccg
gtggttgatctgaacgtcaacccaagcaatcccgtcatcggcaagctcgaccggagcttc
tcggcagatccggttgtcgttgcccagcaggctcgaatggtcatcgatgcgttccaccag
caaggcatcattgctgcgctgaagcacttccccggccacggcagctcgaccaccgatacg
cacaaggattttaccgatgtcaccgccacctggtcaaaaaaagagcttgatccctactgg
gcgctgatccgtgaagggtatagcgatccggtcatgacagcgcacgttttcaacgcccgc
ctcgacagcctctacccggcgacgctctcgaaggcgacgattgacggcctgcttcgcaaa
cagctcggcttccggggtgtggtactcagcgacgacatgcagatgaaagctatcgccgac
cgttatggcctcgaagaggcgatccggctggcgattgacgcaggggtcgatgtgctgatt
ttcggcaacaacgtcagctacgacccggagatcgctagcaaagcaacgagcattatccgc
cacctcgttgaaaaaggggctatttcgccggagaggattaacgaatcgtaccggcggatc
atgaccttgaaaacccgaactatcatttctcgcccatga

DBGET integrated database retrieval system