KEGG   Chlorobaculum tepidum: CT0090Help
Entry
CT0090            CDS       T00088                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cte  Chlorobaculum tepidum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cte00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cte00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
85187..86305
Genome map
AA seq 372 aa AA seqDB search
MKATLLAALLLFLSFTSALAAPSTPDSLSIKIGQMLMIGFRGMEAKDDSAIAADIRERGI
GGVVLFDYDVPSKSPIRNIESPEQLRRLTSELQKLSTTPLFIAVDQEGGRVCRLKPSRGF
PPTVSAAYLGTLNNSDSTWQAAGSTAALLKSLGINVNLAPVVDLNVNPSNPVIGKLDRSF
SADPVVVAQQARMVIDAFHQQGIIAALKHFPGHGSSTTDTHKDFTDVTATWSKKELDPYW
ALIREGYSDPVMTAHVFNARLDSLYPATLSKATIDGLLRKQLGFRGVVLSDDMQMKAIAD
RYGLEEAIRLAIDAGVDVLIFGNNVSYDPEIASKATSIIRHLVEKGAISPERINESYRRI
MTLKTRTIISRP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgactctccttgcggcgctgctgctttttttgagctttacctccgcgctggcc
gcgccatccacgcccgacagtctttcgatcaagatcggccagatgcttatgatcggcttc
cgtggcatggaggccaaagacgattcagctatcgccgctgatattcgcgagcggggcatc
ggcggcgtggtgctgttcgattacgacgtgccatcaaaatctccaattcgcaacatcgag
tcgccggagcagctccggcgtcttacctcggagctgcaaaagctctcgaccactccgctt
ttcattgctgtcgatcaggagggtgggcgcgtctgccgcctcaagccgtcgcgcggcttt
ccgccgaccgtttccgccgcttatctcggcacactcaataattccgacagcacatggcag
gccgccggatcgaccgccgctttactcaaaagtctcggtatcaacgtgaatctcgcgccg
gtggttgatctgaacgtcaacccaagcaatcccgtcatcggcaagctcgaccggagcttc
tcggcagatccggttgtcgttgcccagcaggctcgaatggtcatcgatgcgttccaccag
caaggcatcattgctgcgctgaagcacttccccggccacggcagctcgaccaccgatacg
cacaaggattttaccgatgtcaccgccacctggtcaaaaaaagagcttgatccctactgg
gcgctgatccgtgaagggtatagcgatccggtcatgacagcgcacgttttcaacgcccgc
ctcgacagcctctacccggcgacgctctcgaaggcgacgattgacggcctgcttcgcaaa
cagctcggcttccggggtgtggtactcagcgacgacatgcagatgaaagctatcgccgac
cgttatggcctcgaagaggcgatccggctggcgattgacgcaggggtcgatgtgctgatt
ttcggcaacaacgtcagctacgacccggagatcgctagcaaagcaacgagcattatccgc
cacctcgttgaaaaaggggctatttcgccggagaggattaacgaatcgtaccggcggatc
atgaccttgaaaacccgaactatcatttctcgcccatga

DBGET integrated database retrieval system