KEGG   Chlorobaculum tepidum: CT0185Help
Entry
CT0185            CDS       T00088                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cte  Chlorobaculum tepidum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cte00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
194745..196196
Genome map
AA seq 483 aa AA seqDB search
MAILSIDQGTTGTTCMIYDRTGSVLARAYRELTQHYPQAGWVEHDPEEIWRTVVECVAEV
RGAYSGHIEAIGITNQRETTVVWDRRSGQPVHRAIVWQCRRTAKLCNRYRSEEAAIRAKT
GLPVDAYFSATKIRWILDAHPEIDPSNLLFGTIDTWLIWKLTGGEVHATDLTNASRTLLF
DIHERRWSPELCELFGVPLSMLPEARPSMGGFGSVRTIPALDGVLIAGVAGDQQAALFGQ
CCFAPGSVKNTYGTGCFMVMNTGEKFVSSSHGLLTTLALDGAGRSCYAVEGSVFIGGAVM
QWLRDGLQLIGSAAESETIARSVESNGGVYLVPAFVGLGAPHWNMEARGTITGLTRGSSR
AHIVRAALESIAFQSHDVFRAMVADIGIQPQSLTVDGGAVSNEFLMQLQADLLGVPVHRP
RNIESTALGAACLAGLEAGVWGSAAELRVLNSVERVFTPAMPEGEREALLAGWQKALRQT
LTS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctattctttccatcgatcagggcacgaccggcaccacctgcatgatctacgaccgg
acgggcagcgtgctcgcccgcgcgtatcgcgagttgacgcaacactatccgcaggcgggg
tgggtggagcatgatccggaggagatctggcggacggtggtcgagtgcgtggccgaggtg
cggggcgcatattcgggtcacatcgaagctatcggcatcaccaaccagcgcgagaccacc
gtggtgtgggatcggcggagcggccagcccgtgcaccgcgccatcgtctggcagtgccgg
cggacggccaaattgtgcaaccgctaccgcagcgaggaggcggcgatccgcgcgaagaca
ggactgccggtggacgcctacttcagcgccaccaagattcgctggattctcgacgcgcat
cccgaaatcgatccatcaaatctcctcttcggcaccattgacacgtggctcatctggaag
ctgaccggcggcgaggttcacgcgaccgacctgacgaatgcttcgcgcacgctgttgttt
gatatccacgagcggcgctggtcgcccgagctttgcgagttgtttggcgtgccgctctca
atgctaccggaggcgcgtccgtcgatgggcgggttcggctcggtgcgcacgattccggcg
ctcgatggcgtgctgattgcgggcgtggcgggcgaccagcaggcggcgctttttggccag
tgctgctttgcgccggggtcggtcaagaacacctacggcaccggctgcttcatggtgatg
aacaccggagaaaagtttgtgagttcgagtcacggcttgttgacgacgctcgcgctcgac
ggcgctggccggagctgctacgcggtcgaggggtcggtgttcatcggcggcgcggtgatg
cagtggctgcgcgacggcttgcagctcatcggcagcgccgccgagtctgagacgattgcc
cgctcggttgaatcgaatggaggggtctatctcgtgcccgccttcgtcggtctcggcgca
ccgcactggaacatggaggcgcggggcacgatcaccggcctgacgcgcggctcgtcgcgg
gcgcatattgtccgcgcggcgctggagtcgatcgccttccagtcgcacgacgtgtttcgt
gcgatggtggccgacatcggcattcagccgcagtcgctcacggtcgatggcggcgcggtg
agcaacgagtttctgatgcagctccaggccgacctgctcggcgtgccggtgcaccgtccg
cgcaacatcgaatccactgccctcggcgcggcctgccttgcgggtctcgaagccggagtg
tggggttccgccgccgaactgcgtgtgctcaacagcgtcgagcgggtcttcactcccgcg
atgccggagggcgaacgcgaggcgttgctggcgggctggcaaaaggcgctgcggcagacg
ctcacatcataa

DBGET integrated database retrieval system