KEGG   Chlorobaculum tepidum: CT0185Help
Entry
CT0185            CDS       T00088                                 

Gene name
glpK
Definition
(RefSeq) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00561  Glycerolipid metabolism
cte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CT0185 (glpK)
Enzymes [BR:cte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CT0185 (glpK)
Exosome [BR:cte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CT0185 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 1007614
NCBI-ProteinID: NP_661091
CyanoBase: CT0185
CYORF: CT0185
UniProt: Q8KFY5
Position
194745..196196
Genome map
AA seq 483 aa AA seqDB search
MAILSIDQGTTGTTCMIYDRTGSVLARAYRELTQHYPQAGWVEHDPEEIWRTVVECVAEV
RGAYSGHIEAIGITNQRETTVVWDRRSGQPVHRAIVWQCRRTAKLCNRYRSEEAAIRAKT
GLPVDAYFSATKIRWILDAHPEIDPSNLLFGTIDTWLIWKLTGGEVHATDLTNASRTLLF
DIHERRWSPELCELFGVPLSMLPEARPSMGGFGSVRTIPALDGVLIAGVAGDQQAALFGQ
CCFAPGSVKNTYGTGCFMVMNTGEKFVSSSHGLLTTLALDGAGRSCYAVEGSVFIGGAVM
QWLRDGLQLIGSAAESETIARSVESNGGVYLVPAFVGLGAPHWNMEARGTITGLTRGSSR
AHIVRAALESIAFQSHDVFRAMVADIGIQPQSLTVDGGAVSNEFLMQLQADLLGVPVHRP
RNIESTALGAACLAGLEAGVWGSAAELRVLNSVERVFTPAMPEGEREALLAGWQKALRQT
LTS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctattctttccatcgatcagggcacgaccggcaccacctgcatgatctacgaccgg
acgggcagcgtgctcgcccgcgcgtatcgcgagttgacgcaacactatccgcaggcgggg
tgggtggagcatgatccggaggagatctggcggacggtggtcgagtgcgtggccgaggtg
cggggcgcatattcgggtcacatcgaagctatcggcatcaccaaccagcgcgagaccacc
gtggtgtgggatcggcggagcggccagcccgtgcaccgcgccatcgtctggcagtgccgg
cggacggccaaattgtgcaaccgctaccgcagcgaggaggcggcgatccgcgcgaagaca
ggactgccggtggacgcctacttcagcgccaccaagattcgctggattctcgacgcgcat
cccgaaatcgatccatcaaatctcctcttcggcaccattgacacgtggctcatctggaag
ctgaccggcggcgaggttcacgcgaccgacctgacgaatgcttcgcgcacgctgttgttt
gatatccacgagcggcgctggtcgcccgagctttgcgagttgtttggcgtgccgctctca
atgctaccggaggcgcgtccgtcgatgggcgggttcggctcggtgcgcacgattccggcg
ctcgatggcgtgctgattgcgggcgtggcgggcgaccagcaggcggcgctttttggccag
tgctgctttgcgccggggtcggtcaagaacacctacggcaccggctgcttcatggtgatg
aacaccggagaaaagtttgtgagttcgagtcacggcttgttgacgacgctcgcgctcgac
ggcgctggccggagctgctacgcggtcgaggggtcggtgttcatcggcggcgcggtgatg
cagtggctgcgcgacggcttgcagctcatcggcagcgccgccgagtctgagacgattgcc
cgctcggttgaatcgaatggaggggtctatctcgtgcccgccttcgtcggtctcggcgca
ccgcactggaacatggaggcgcggggcacgatcaccggcctgacgcgcggctcgtcgcgg
gcgcatattgtccgcgcggcgctggagtcgatcgccttccagtcgcacgacgtgtttcgt
gcgatggtggccgacatcggcattcagccgcagtcgctcacggtcgatggcggcgcggtg
agcaacgagtttctgatgcagctccaggccgacctgctcggcgtgccggtgcaccgtccg
cgcaacatcgaatccactgccctcggcgcggcctgccttgcgggtctcgaagccggagtg
tggggttccgccgccgaactgcgtgtgctcaacagcgtcgagcgggtcttcactcccgcg
atgccggagggcgaacgcgaggcgttgctggcgggctggcaaaaggcgctgcggcagacg
ctcacatcataa

DBGET integrated database retrieval system