KEGG   Chlorobium tepidum: CT0202Help
Entry
CT0202            CDS       T00088                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate (D-aspartate) O-methyltransferase
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cte  Chlorobium tepidum
Brite
Enzymes [BR:cte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CT0202 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
213432..214073
Genome map
AA seq 213 aa AA seqDB search
MARERQEMVVELKRYGISNARVLDAFLTVRRHLFVDAQSRPYAYSDNAMPIGFGQTISQP
YTVAYMTSLLVERVPSGKVLEIGTGSGYQAAILAELGYRVYTIERIAGLYAAAGRVLDAL
GLPVHPRLGDGTLGWPEEAPFDGIIVTAAAPREPHTLMSQLAEGGVLVVPIGDLGSQQMT
VIRRRGERFEHEIFHNFAFVPLCGREGWADNNE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctcgggagcgccaggagatggtggtagagctcaagcgttacggtatcagcaacgcc
cgagtgctcgatgcgtttctgacggtcaggcgtcatctctttgtcgatgcacagagccgg
ccctacgcctacagcgacaatgctatgccgatcggattcggccagaccatttcgcagccc
tatacggtggcgtacatgacttcgctgctggtggagcgcgttccatccggcaaggtgctt
gaaatcggtaccggttcgggctaccaggcggctattctcgccgagcttggctatcgtgtc
tataccatcgagcggattgccgggttgtacgcagcggcggggcgcgtgctcgatgcgctt
ggtttgcccgttcacccgcgtctcggtgatggaacgctcggctggccggaggaggcgccg
ttcgacggcatcatcgtgaccgccgccgcgccgcgcgagccgcatacgctcatgagccag
cttgccgaaggcggcgtgctcgttgtgccgattggcgacctcggttcacagcagatgacc
gtcattcggcgcaggggcgagcggttcgagcatgagatttttcacaacttcgccttcgtg
ccgctctgcgggcgtgaaggttgggcagacaacaacgaataa

DBGET integrated database retrieval system