KEGG   Chlorobaculum tepidum: CT0247Help
Entry
CT0247            CDS       T00088                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00230  Purine metabolism
cte01100  Metabolic pathways
Module
cte_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CT0247 (gmk)
Enzymes [BR:cte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CT0247 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 Cytidylate_kin AAA_22 AAA AAA_30 NTPase_1 AAA_25 ABC_tran RsgA_GTPase RNA_helicase
Motif
Other DBs
NCBI-GeneID: 1007740
NCBI-ProteinID: NP_661151
CyanoBase: CT0247
CYORF: CT0247
UniProt: Q8KFS5
Position
258269..258856
Genome map
AA seq 195 aa AA seqDB search
MSAEQVLDQGRLIVFSAPSGTGKSTVAKLVMERLGSLEFSVSATTRQMRAGERDGVDYHF
LSREEFEKKIAENGFIEHEFFFGNFYGTLLDKTIDAIKAGHNLLFDLDVKGALNLKRIFG
DQALLVFLKPPSMEELARRLQARDSESAEALKSRLERAEMELSHAGEFDFVVVNDDLGRT
VDAVATRIAEFLPQP
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagaacaggttttggaccagggcaggctgatcgtcttttccgcgccttccggc
accgggaaatcgacggttgcaaaactcgtgatggagcgtctcggctctctcgaattttct
gtttcggctaccacgcgccagatgagagctggcgagcgcgatggcgtcgattaccacttt
ctctcccgcgaagagtttgagaaaaagatcgctgaaaatggcttcatcgaacacgagttc
tttttcggtaacttctatgggacgctcctcgacaagaccatcgatgcgatcaaagcgggc
cacaatctgcttttcgatctcgatgtgaagggtgcgctgaacctcaagagaatttttgga
gaccaggcgctgctcgttttcctcaaacccccaagcatggaggagcttgcccgccgcctg
caggcgcgcgatagcgagagtgccgaagcgctgaaaagccgtctcgaacgagcggagatg
gagctttcccatgccggagagttcgattttgtcgtggtcaacgacgatctcgggcgcacc
gtcgatgcggttgcgacgcggatcgccgagtttcttccacaaccataa

DBGET integrated database retrieval system