KEGG   Chlorobaculum tepidum: CT0250Help
Entry
CT0250            CDS       T00088                                 

Gene name
pfk-2
Definition
(RefSeq) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00010  Glycolysis / Gluconeogenesis
cte00030  Pentose phosphate pathway
cte00051  Fructose and mannose metabolism
cte00052  Galactose metabolism
cte00680  Methane metabolism
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01120  Microbial metabolism in diverse environments
cte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT0250 (pfk-2)
   00030 Pentose phosphate pathway
    CT0250 (pfk-2)
   00051 Fructose and mannose metabolism
    CT0250 (pfk-2)
   00052 Galactose metabolism
    CT0250 (pfk-2)
  Energy metabolism
   00680 Methane metabolism
    CT0250 (pfk-2)
Enzymes [BR:cte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CT0250 (pfk-2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CT0250 (pfk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 1007748
NCBI-ProteinID: NP_661154
CyanoBase: CT0250
CYORF: CT0250
UniProt: Q8KFS2
Position
259749..260921
Genome map
AA seq 390 aa AA seqDB search
MHIGVLTGGGDAPGINACIKTIVTISTEKGYRVTGIRRGWNGLLAFDPDDPASRTEHIVD
LDSELVRRIDRTGGTLLHTSRINPGNLKKKEIPPFLRNSPHLLRTGLHHSGNFDLTDHVL
RSIDALGLDVIIVIGGDDTIGYADHLAKAAVKVIGVPKTMDNDVYGSDYCIGFGTAVTRS
VQYIHQLRTSSGSHERITIVELFGRSTGETCLVSAYLAGVDRALIPEVPFDPETLADYVI
QDKAANPSQYAMIAISEGARMIGSKMIEYCGRRYDEDGHEPAGIGQLTRETISMLTGQDV
ICQQLGYLMRSGIPDALDLMVGFNFAQLAVELIAEGTFGVMVALQKGIYTCLPLAEVSSN
TKQVDISELYDPRYYRPKMRSVMGKPMFLY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcggtgttttgaccggcggcggcgacgctcccggcatcaacgcgtgcatcaag
accatcgtgacgatcagcacggagaaagggtatcgggtgaccggtatccgcaggggctgg
aacggtcttctggcgtttgatcccgatgatccggcatcccgcacggagcatatcgtcgat
cttgactccgagcttgtccgcagaatcgatcgtactggcggcaccctgcttcacaccagc
cgcatcaatcccggcaacctcaaaaagaaagaaattccaccatttcttcgcaactcgcca
cacctgttgcgcacgggcttgcatcactccggaaactttgatctgaccgatcatgtgttg
cggagtattgatgcgcttggcctggatgtcatcattgtcatcggcggtgacgacacgatc
ggctatgccgatcacctggccaaagctgctgtcaaggtgattggcgtgccaaagacgatg
gacaacgatgtttatggctcggactactgcatcgggtttggcacggccgttacccgcagt
gtccagtacattcatcagctgcgtaccagttccggctcgcacgagcgaatcactattgtc
gagctgttcggtcgtagcaccggggaaacctgcctcgtcagtgcctacctggccggtgtt
gaccgcgccctcattccggaagtgcctttcgaccccgaaactctcgccgattacgttatt
caggacaaagcagccaatccgagccaatatgccatgattgctatcagtgaaggtgcgcgg
atgattggcagcaagatgatcgaatattgcggacggcggtacgacgaggatggccatgag
cctgccggaattggccaattgacccgtgaaaccatctccatgctgaccggccaggatgtc
atctgccagcagctgggctatctgatgcgttcaggtattcccgatgctctggatctgatg
gtcggcttcaattttgcgcagcttgccgtggaactgattgcagaaggcaccttcggtgtc
atggtggcgctccagaaaggcatctacacctgtctcccccttgcagaggtgtcgtcaaac
accaagcaggtcgatatcagtgaactgtatgacccgcgctactaccgcccgaagatgcga
agcgtcatgggcaagccgatgtttctttattag

DBGET integrated database retrieval system