KEGG   Chlorobium tepidum: CT0250Help
Entry
CT0250            CDS       T00088                                 

Gene name
pfk-2
Definition
(RefSeq) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cte  Chlorobium tepidum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT0250 (pfk-2)
   00030 Pentose phosphate pathway
    CT0250 (pfk-2)
   00051 Fructose and mannose metabolism
    CT0250 (pfk-2)
   00052 Galactose metabolism
    CT0250 (pfk-2)
  Energy metabolism
   00680 Methane metabolism
    CT0250 (pfk-2)
Enzymes [BR:cte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CT0250 (pfk-2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CT0250 (pfk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
259749..260921
Genome map
AA seq 390 aa AA seqDB search
MHIGVLTGGGDAPGINACIKTIVTISTEKGYRVTGIRRGWNGLLAFDPDDPASRTEHIVD
LDSELVRRIDRTGGTLLHTSRINPGNLKKKEIPPFLRNSPHLLRTGLHHSGNFDLTDHVL
RSIDALGLDVIIVIGGDDTIGYADHLAKAAVKVIGVPKTMDNDVYGSDYCIGFGTAVTRS
VQYIHQLRTSSGSHERITIVELFGRSTGETCLVSAYLAGVDRALIPEVPFDPETLADYVI
QDKAANPSQYAMIAISEGARMIGSKMIEYCGRRYDEDGHEPAGIGQLTRETISMLTGQDV
ICQQLGYLMRSGIPDALDLMVGFNFAQLAVELIAEGTFGVMVALQKGIYTCLPLAEVSSN
TKQVDISELYDPRYYRPKMRSVMGKPMFLY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcggtgttttgaccggcggcggcgacgctcccggcatcaacgcgtgcatcaag
accatcgtgacgatcagcacggagaaagggtatcgggtgaccggtatccgcaggggctgg
aacggtcttctggcgtttgatcccgatgatccggcatcccgcacggagcatatcgtcgat
cttgactccgagcttgtccgcagaatcgatcgtactggcggcaccctgcttcacaccagc
cgcatcaatcccggcaacctcaaaaagaaagaaattccaccatttcttcgcaactcgcca
cacctgttgcgcacgggcttgcatcactccggaaactttgatctgaccgatcatgtgttg
cggagtattgatgcgcttggcctggatgtcatcattgtcatcggcggtgacgacacgatc
ggctatgccgatcacctggccaaagctgctgtcaaggtgattggcgtgccaaagacgatg
gacaacgatgtttatggctcggactactgcatcgggtttggcacggccgttacccgcagt
gtccagtacattcatcagctgcgtaccagttccggctcgcacgagcgaatcactattgtc
gagctgttcggtcgtagcaccggggaaacctgcctcgtcagtgcctacctggccggtgtt
gaccgcgccctcattccggaagtgcctttcgaccccgaaactctcgccgattacgttatt
caggacaaagcagccaatccgagccaatatgccatgattgctatcagtgaaggtgcgcgg
atgattggcagcaagatgatcgaatattgcggacggcggtacgacgaggatggccatgag
cctgccggaattggccaattgacccgtgaaaccatctccatgctgaccggccaggatgtc
atctgccagcagctgggctatctgatgcgttcaggtattcccgatgctctggatctgatg
gtcggcttcaattttgcgcagcttgccgtggaactgattgcagaaggcaccttcggtgtc
atggtggcgctccagaaaggcatctacacctgtctcccccttgcagaggtgtcgtcaaac
accaagcaggtcgatatcagtgaactgtatgacccgcgctactaccgcccgaagatgcga
agcgtcatgggcaagccgatgtttctttattag

DBGET integrated database retrieval system