KEGG   Chlorobium tepidum: CT0262Help
Entry
CT0262            CDS       T00088                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cte  Chlorobium tepidum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CT0262 (ruvA)
Enzymes [BR:cte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CT0262 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
272059..272664
Genome map
AA seq 201 aa AA seqDB search
MFAFLRGELVTVSREEAVVEVSGIGYLLHISSGTSRRLPPEGSQVRLFTHHYVREDAQQL
FGFLDEEELQLFRLLLTIGGVGPKLAMAVLSGLSVGEIQEAIVANRPETLYGITGVGKKT
ASRIILELRDKILKIQPAASGKTAGAPQALQLNEDALAALMTLGFPKPAAQKAISGILET
SPGLSVEEVVRAALIAIHNNF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcatttttgagaggtgagctggtaacagtctcccgtgaggaggcggttgtcgag
gtatccggcatcgggtacctgctgcacatctcgtccggcacgagccgccgcctgcccccg
gaggggagtcaggttcgtctctttacccatcactacgttcgcgaggatgctcagcaactt
ttcggctttctcgacgaagaagagcttcagcttttccgcttgttgcttaccatcggtgga
gtcggaccgaagctggcgatggctgtgctgtcgggtctgagcgttggcgaaatccaggaa
gcgattgtcgccaatcgtccggaaaccctttacggcattaccggtgtgggcaaaaaaacc
gcctcccgtatcattctcgaactgagggacaagattctcaaaatccagccagcggcaagc
ggcaaaacggcgggtgcgcctcaagctcttcaactgaacgaagatgccctcgcggcgctc
atgacgctcggttttccgaagccagcggctcagaaagccatttcgggcattctggagact
tctcccggcttgtcggtcgaagaggttgtcagggccgcgcttatcgctattcacaacaac
ttctga

DBGET integrated database retrieval system